Property Summary

NCBI Gene PubMed Count 37
Grant Count 66
R01 Count 28
Funding $6,908,536.77
PubMed Score 158.46
PubTator Score 109.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.505 0.000
atypical teratoid / rhabdoid tumor -1.200 0.000
non primary Sjogren syndrome sicca 1.100 0.029
ovarian cancer 1.700 0.000

Synonym

Accession Q14249 Q5T281 Q9BSP2 Endo G
Symbols

Gene

Gene RIF (30)

PMID Text
27239850 These findings suggest that non-viral DNA vectors are also substrates for EndoG in its role in homologous recombination
26492643 our study established a link between Endo G and mitochondrial function during cardiac hypertrophy
25436615 Results show that BNIP3 interacts with the voltage-dependent anion channel (VDAC) to directly induce mitochondrial release and nuclear translocation of EndoG.
25401220 Data suggest that endonuclease G (EndoG) inhibitors have the potential to be utilized for amelioration of cell injuries in which participation of EndoG is essential.
25139236 study demonstrate EndoG interacts with cellular Inhibitor of Apoptosis Protein 1 (cIAP1); results indicate IAPs interact and ubiquitinate EndoG via K63-mediated isopeptide linkages without affecting EndoG levels and EndoG-mediated cell death, suggesting EndoG ubiquitination by IAPs may serve as a regulatory signal independent of proteasomal degradation
25132265 Endonuclease G (EndoG), an apoptotic nuclease, as an essential factor for MLLbcr-specific DNA recombination after induction of replication stress.
24371120 Data indicate that older muscles showed a 3-fold greater fraction of endonuclease G (a mitochondrial proapoptotic factor)-positive myonuclei.
24129513 Endonuclease G mediates alpha-synuclein cytotoxicity during Parkinson's disease.
24038028 Using gene reporter assays, we show that promoter variations in 11 intrinsic apoptosis genes, including ADPRT, APAF1, BCL2, BAD, BID, MCL1, BIRC4, BCL2L1, ENDOG, YWHAB, and YWHAQ, influence promoter activity in an allele-specific manner.
23986585 These data indicate that HSV-1 UL12.5 deploys cellular proteins, including ENDOG and EXOG, to destroy mtDNA and contribute to a growing body of literature highlighting roles for ENDOG and EXOG in mtDNA maintenance.
More...

AA Sequence

MRALRAGLTLASGAGLGAVVEGWRRRREDARAAPGLLGRLPVLPVAAAAELPPVPGGPRGPGELAKYGLP      1 - 70
GLAQLKSRESYVLCYDPRTRGALWVVEQLRPERLRGDGDRRECDFREDDSVHAYHRATNADYRGSGFDRG     71 - 140
HLAAAANHRWSQKAMDDTFYLSNVAPQVPHLNQNAWNNLEKYSRSLTRSYQNVYVCTGPLFLPRTEADGK    141 - 210
SYVKYQVIGKNHVAVPTHFFKVLILEAAGGQIELRTYVMPNAPVDEAIPLERFLVPIESIERASGLLFVP    211 - 280
NILARAGSLKAITAGSK                                                         281 - 297
//

Text Mined References (39)

PMID Year Title
27239850 [Effect of endonuclease G depletion on plasmid DNA uptake and levels of homologous recombination in hela cells].
26492643 2015 Characterization of endonuclease G and mitochondria-sarcoplasmic reticulum-related proteins during cardiac hypertrophy.
25436615 2014 The proapoptotic protein BNIP3 interacts with VDAC to induce mitochondrial release of endonuclease G.
25401220 2015 Novel cytoprotective inhibitors for apoptotic endonuclease G.
25139236 2014 Cellular inhibitor of apoptosis protein 1 ubiquitinates endonuclease G but does not affect endonuclease G-mediated cell death.
25132265 2015 Endonuclease G initiates DNA rearrangements at the MLL breakpoint cluster upon replication stress.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24371120 2014 Increased sensitivity to mitochondrial permeability transition and myonuclear translocation of endonuclease G in atrophied muscle of physically active older humans.
24129513 2013 Endonuclease G mediates ?-synuclein cytotoxicity during Parkinson's disease.
24038028 2014 Impact of promoter polymorphisms in key regulators of the intrinsic apoptosis pathway on the outcome of childhood acute lymphoblastic leukemia.
More...