Property Summary

NCBI Gene PubMed Count 42
PubMed Score 175.85
PubTator Score 109.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Cancer 2499 3.889 1.9

Expression

  Differential Expression (4)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.200 1.1e-05
non primary Sjogren syndrome sicca 1.100 2.9e-02
osteosarcoma -1.505 2.0e-04
ovarian cancer 1.700 2.6e-05

Gene RIF (35)

AA Sequence

MRALRAGLTLASGAGLGAVVEGWRRRREDARAAPGLLGRLPVLPVAAAAELPPVPGGPRGPGELAKYGLP      1 - 70
GLAQLKSRESYVLCYDPRTRGALWVVEQLRPERLRGDGDRRECDFREDDSVHAYHRATNADYRGSGFDRG     71 - 140
HLAAAANHRWSQKAMDDTFYLSNVAPQVPHLNQNAWNNLEKYSRSLTRSYQNVYVCTGPLFLPRTEADGK    141 - 210
SYVKYQVIGKNHVAVPTHFFKVLILEAAGGQIELRTYVMPNAPVDEAIPLERFLVPIESIERASGLLFVP    211 - 280
NILARAGSLKAITAGSK                                                         281 - 297
//

Text Mined References (44)

PMID Year Title