Property Summary

NCBI Gene PubMed Count 206
Grant Count 340
R01 Count 195
Funding $25,262,512.35
PubMed Score 411.24
PubTator Score 375.50

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q14247 Q8N707 Q96H99
Symbols EMS1

Gene

PDB

2D1X   1X69  

Gene RIF (150)

PMID Text
26602019 findings reveal that Keap1 regulates cell migration by affecting the subcellular localization and activity of cortactin independently of its role in oxidant stress responses.
26490115 the MCP1-induced cortactin phosphorylation is dependent on PLCb3-mediated PKC activation, and siRNA-mediated down-regulation of either of these molecules prevents cortactin interaction with WAVE2
26385474 Study highlights the potential role of CCM3 in regulating tight junction complex organization and brain endothelial barrier permeability through CCM3-ERK1/2-cortactin cross-talk
26361873 These findings suggest that this common cortactin variant may functionally contribute to ALI predisposition by impeding endothelial wound healing.
26330014 We identified and confirmed that Fra-1 affected the expression level of CTTN and EZR in vitro through LC-MS/MS analyses and western blot technology.
26323691 These data suggest a model in which phosphatidylinositol 3,5-bisphosphate binding removes cortactin from late endosomal branched actin networks and thereby promotes net actin turnover.
26289258 The results indicate that cortactin is involved in the regulation of apoptosis induced by VacA in gastric cells.
26246421 acetylation-mimicking mutants of alpha-tubulin and cortactin counteract HDAC6-induced ciliary disassembly.
26243395 Cortactin expression in epithelial ovarian carcinoma was closely related to malignant biological behavior
26238396 cortactin is crucial in invasion and migration of glioma cells, which may promote the migration and invasion of glioma cells by regulating lamellipodia formation, a process requiring the combination of cortactin and the Arp2/3 complex
More...

AA Sequence

MWKASAGHAVSIAQDDAGADDWETDPDFVNDVSEKEQRWGAKTVQGSGHQEHINIHKLRENVFQEHQTLK      1 - 70
EKELETGPKASHGYGGKFGVEQDRMDKSAVGHEYQSKLSKHCSQVDSVRGFGGKFGVQMDRVDQSAVGFE     71 - 140
YQGKTEKHASQKDYSSGFGGKYGVQADRVDKSAVGFDYQGKTEKHESQRDYSKGFGGKYGIDKDKVDKSA    141 - 210
VGFEYQGKTEKHESQKDYVKGFGGKFGVQTDRQDKCALGWDHQEKLQLHESQKDYKTGFGGKFGVQSERQ    211 - 280
DSAAVGFDYKEKLAKHESQQDYSKGFGGKYGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNI    281 - 350
RANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPV    351 - 420
YEDAASFKAELSYRGPVSGTEPEPVYSMEAADYREASSQQGLAYATEAVYESAEAPGHYPAEDSTYDEYE    421 - 490
NDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANYVELRQ              491 - 550
//

Text Mined References (225)

PMID Year Title
26602019 2015 The subcellular localization and activity of cortactin is regulated by acetylation and interaction with Keap1.
26490115 2015 PLC?3 mediates cortactin interaction with WAVE2 in MCP1-induced actin polymerization and cell migration.
26385474 2015 PDCD10 (CCM3) regulates brain endothelial barrier integrity in cerebral cavernous malformation type 3: role of CCM3-ERK1/2-cortactin cross-talk.
26361873 2015 A genetic variant of cortactin linked to acute lung injury impairs lamellipodia dynamics and endothelial wound healing.
26330014 2015 Fra-1 is upregulated in gastric cancer tissues and affects the PI3K/Akt and p53 signaling pathway in gastric cancer.
26323691 2015 PI(3,5)P2 controls endosomal branched actin dynamics by regulating cortactin-actin interactions.
26289258 2016 Cortactin Mediates Apoptosis of Gastric Epithelial Cells Induced by VacA Protein of Helicobacter pylori.
26246421 2015 Deacetylation of ?-tubulin and cortactin is required for HDAC6 to trigger ciliary disassembly.
26243395 2016 Expression and clinical significance of cortactin protein in ovarian neoplasms.
26238396 2015 Expression of cortactin in human gliomas and its effect on migration and invasion of glioma cells.
More...