Property Summary

NCBI Gene PubMed Count 13
Grant Count 6
Funding $311,975.97
PubMed Score 15.09
PubTator Score 20.83

Knowledge Summary

Patent (3,703)

Expression

  Differential Expression (13)

Disease log2 FC p
malignant mesothelioma -5.500 0.000
uncontrolled asthma 1.100 0.016
cutaneous lupus erythematosus 1.500 0.016
osteosarcoma -2.565 0.000
atypical teratoid / rhabdoid tumor 1.100 0.000
glioblastoma 1.300 0.000
medulloblastoma, large-cell 1.400 0.000
non-small cell lung cancer -1.702 0.000
lung cancer -1.500 0.000
lung adenocarcinoma -1.800 0.000
adult high grade glioma 1.400 0.001
lung carcinoma -1.900 0.000
psoriasis 1.300 0.000

Gene RIF (3)

PMID Text
20625511 Additional transcription changes likely associated with Th2-like eosinophilic inflammation were prominent and included increased EMR1&3.
20424473 Observational study of gene-disease association. (HuGE Navigator)
17823986 Highly specific marker for eosinophils.

AA Sequence

MRGFNLLLFWGCCVMHSWEGHIRPTRKPNTKGNNCRDSTLCPAYATCTNTVDSYYCACKQGFLSSNGQNH      1 - 70
FKDPGVRCKDIDECSQSPQPCGPNSSCKNLSGRYKCSCLDGFSSPTGNDWVPGKPGNFSCTDINECLTSS     71 - 140
VCPEHSDCVNSMGSYSCSCQVGFISRNSTCEDVDECADPRACPEHATCNNTVGNYSCFCNPGFESSSGHL    141 - 210
SFQGLKASCEDIDECTEMCPINSTCTNTPGSYFCTCHPGFAPSNGQLNFTDQGVECRDIDECRQDPSTCG    211 - 280
PNSICTNALGSYSCGCIAGFHPNPEGSQKDGNFSCQRVLFKCKEDVIPDNKQIQQCQEGTAVKPAYVSFC    281 - 350
AQINNIFSVLDKVCENKTTVVSLKNTTESFVPVLKQISTWTKFTKEETSSLATVFLESVESMTLASFWKP    351 - 420
SANITPAVRTEYLDIESKVINKECSEENVTLDLVAKGDKMKIGCSTIEESESTETTGVAFVSFVGMESVL    421 - 490
NERFFKDHQAPLTTSEIKLKMNSRVVGGIMTGEKKDGFSDPIIYTLENIQPKQKFERPICVSWSTDVKGG    491 - 560
RWTSFGCVILEASETYTICSCNQMANLAVIMASGELTMDFSLYIISHVGIIISLVCLVLAIATFLLCRSI    561 - 630
RNHNTYLHLHLCVCLLLAKTLFLAGIHKTDNKMGCAIIAGFLHYLFLACFFWMLVEAVILFLMVRNLKVV    631 - 700
NYFSSRNIKMLHICAFGYGLPMLVVVISASVQPQGYGMHNRCWLNTETGFIWSFLGPVCTVIVINSLLLT    701 - 770
WTLWILRQRLSSVNAEVSTLKDTRLLTFKAFAQLFILGCSWVLGIFQIGPVAGVMAYLFTIINSLQGAFI    771 - 840
FLIHCLLNGQVREEYKRWITGKTKPSSQSQTSRILLSSMPSASKTG                            841 - 886
//

Text Mined References (16)

PMID Year Title
25713288 2015 International Union of Basic and Clinical Pharmacology. XCIV. Adhesion G protein-coupled receptors.
24530099 2014 The eosinophil surface receptor epidermal growth factor-like module containing mucin-like hormone receptor 1 (EMR1): a novel therapeutic target for eosinophilic disorders.
23459936 2013 Exploring the genetic basis of chronic periodontitis: a genome-wide association study.
20625511 2010 Gene transcription changes in asthmatic chronic rhinosinusitis with nasal polyps and comparison to those in atopic dermatitis.
20424473 2010 L-type voltage-dependent calcium channel alpha subunit 1C is a novel candidate gene associated with secondary hyperparathyroidism: an application of haplotype-based analysis for multiple linked single nucleotide polymorphisms.
17823986 2007 EMR1, the human homolog of F4/80, is an eosinophil-specific receptor.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...