Property Summary

NCBI Gene PubMed Count 29
Grant Count 4
R01 Count 4
Funding $387,164.75
PubMed Score 20.80
PubTator Score 24.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis 2.000 0.000
osteosarcoma 1.922 0.000
glioblastoma 1.500 0.000
atypical teratoid / rhabdoid tumor 1.400 0.000
medulloblastoma, large-cell 1.600 0.000
pediatric high grade glioma 1.300 0.000
ovarian cancer 1.400 0.000

Synonym

Accession Q14241 B2R7Q8 Q8IXH1
Symbols SIII
TCEB3
TCEB3A
SIII p110

Gene

PANTHER Protein Class (1)

PDB

4HFX  

 GO Function (1)

Gene RIF (7)

PMID Text
24351681 TCEB3C is a putative tumor suppressor gene of small intestinal neuroendocrine tumors
23828199 Elongin A transcription elongation activity, but not its ubiquitination activity, is most important for its function in induction of transcription of ATF3 and p21.
19730683 Observational study of gene-disease association. (HuGE Navigator)
18976975 Knockdown of transcription elongation factor B (SIII), polypeptide 3 (TCEB3) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
18187620 Knockdown of transcription elongation factor B (SIII), polypeptide 3 (TCEB3) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
17690245 HIV-1 Nef expression in HeLa cells upregulates transcription elongation factor B (SIII; elongin A) expression
11810028 HIV-1 Nef expression in HeLa cells upregulates transcription elongation factor B (SIII; elongin A) expression

AA Sequence

MHGGRSCGPRTRREPSSGEEAAPVTAMAAESALQVVEKLQARLAANPDPKKLLKYLKKLSTLPITVDILA      1 - 70
ETGVGKTVNSLRKHEHVGSFARDLVAQWKKLVPVERNAEPDEQDFEKSNSRKRPRDALQKEEEMEGDYQE     71 - 140
TWKATGSRSYSPDHRQKKHRKLSELERPHKVSHGHERRDERKRCHRMSPTYSSDPESSDYGHVQSPPSCT    141 - 210
SPHQMYVDHYRSLEEDQEPIVSHQKPGKGHSNAFQDRLGASQERHLGEPHGKGVVSQNKEHKSSHKDKRP    211 - 280
VDAKSDEKASVVSREKSHKALSKEENRRPPSGDNAREKPPSSGVKKEKDREGSSLKKKCLPPSEAASDNH    281 - 350
LKKPKHRDPEKAKLDKSKQGLDSFDTGKGAGDLLPKVKEKGSNNLKTPEGKVKTNLDRKSLGSLPKVEET    351 - 420
DMEDEFEQPTMSFESYLSYDQPRKKKKKIVKTSATALGDKGLKKNDSKSTGKNLDSVQKLPKVNKTKSEK    421 - 490
PAGADLAKLRKVPDVLPVLPDLPLPAIQANYRPLPSLELISSFQPKRKAFSSPQEEEEAGFTGRRMNSKM    491 - 560
QVYSGSKCAYLPKMMTLHQQCIRVLKNNIDSIFEVGGVPYSVLEPVLERCTPDQLYRIEEYNHVLIEETD    561 - 630
QLWKVHCHRDFKEERPEEYESWREMYLRLQDAREQRLRVLTKNIQFAHANKPKGRQAKMAFVNSVAKPPR    631 - 700
DVRRRQEKFGTGGAAVPEKIKIKPAPYPMGSSHASASSISFNPSPEEPAYDGPSTSSAHLAPVVSSTVSY    701 - 770
DPRKPTVKKIAPMMAKTIKAFKNRFSRR                                              771 - 798
//

Text Mined References (34)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24351681 2014 TCEB3C a putative tumor suppressor gene of small intestinal neuroendocrine tumors.
23828199 2013 Transcriptional properties of mammalian elongin A and its role in stress response.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19730683 2009 The variant rs1867277 in FOXE1 gene confers thyroid cancer susceptibility through the recruitment of USF1/USF2 transcription factors.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
More...