Property Summary

NCBI Gene PubMed Count 30
PubMed Score 22.11
PubTator Score 24.90

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.400 2.3e-07
glioblastoma 1.100 2.9e-07
medulloblastoma, large-cell 1.600 3.8e-05
osteosarcoma 1.922 8.8e-08
ovarian cancer 1.400 5.0e-06
pediatric high grade glioma 1.300 5.7e-08
psoriasis 2.000 4.5e-05

Gene RIF (8)

AA Sequence

MHGGRSCGPRTRREPSSGEEAAPVTAMAAESALQVVEKLQARLAANPDPKKLLKYLKKLSTLPITVDILA      1 - 70
ETGVGKTVNSLRKHEHVGSFARDLVAQWKKLVPVERNAEPDEQDFEKSNSRKRPRDALQKEEEMEGDYQE     71 - 140
TWKATGSRSYSPDHRQKKHRKLSELERPHKVSHGHERRDERKRCHRMSPTYSSDPESSDYGHVQSPPSCT    141 - 210
SPHQMYVDHYRSLEEDQEPIVSHQKPGKGHSNAFQDRLGASQERHLGEPHGKGVVSQNKEHKSSHKDKRP    211 - 280
VDAKSDEKASVVSREKSHKALSKEENRRPPSGDNAREKPPSSGVKKEKDREGSSLKKKCLPPSEAASDNH    281 - 350
LKKPKHRDPEKAKLDKSKQGLDSFDTGKGAGDLLPKVKEKGSNNLKTPEGKVKTNLDRKSLGSLPKVEET    351 - 420
DMEDEFEQPTMSFESYLSYDQPRKKKKKIVKTSATALGDKGLKKNDSKSTGKNLDSVQKLPKVNKTKSEK    421 - 490
PAGADLAKLRKVPDVLPVLPDLPLPAIQANYRPLPSLELISSFQPKRKAFSSPQEEEEAGFTGRRMNSKM    491 - 560
QVYSGSKCAYLPKMMTLHQQCIRVLKNNIDSIFEVGGVPYSVLEPVLERCTPDQLYRIEEYNHVLIEETD    561 - 630
QLWKVHCHRDFKEERPEEYESWREMYLRLQDAREQRLRVLTKNIQFAHANKPKGRQAKMAFVNSVAKPPR    631 - 700
DVRRRQEKFGTGGAAVPEKIKIKPAPYPMGSSHASASSISFNPSPEEPAYDGPSTSSAHLAPVVSSTVSY    701 - 770
DPRKPTVKKIAPMMAKTIKAFKNRFSRR                                              771 - 798
//

Text Mined References (35)

PMID Year Title