Property Summary

NCBI Gene PubMed Count 28
Grant Count 95
R01 Count 66
Funding $13,036,923.56
PubMed Score 174.31
PubTator Score 104.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.043 0.011
Multiple myeloma 1.233 0.002
glioblastoma -1.200 0.001
atypical teratoid / rhabdoid tumor -1.100 0.000
subependymal giant cell astrocytoma -1.239 0.005
ovarian cancer -1.200 0.002

Synonym

Accession Q14240 D3DNU9 Q53XJ6 Q96B90 Q96EA8 eIF-4A-II
Symbols DDX2B
EIF4A
EIF4F
BM-010
eIF4A-II
eIF-4A-II

Gene

PDB

3BOR  

 GWAS Trait (1)

Gene RIF (14)

PMID Text
26614665 Studies indicate a developing focus on targeting eukaryotic initiation factor 4A eIF4A1 and eIF4A2 as cancer therapy.
23867391 expression is an independent prognostic factor for patients with non-small-cell lung cancer for both overall survival and disease-free survival
23559250 These data support a linear model for miRNA-mediated gene regulation in which translational repression via eIF4A2 is required first, followed by mRNA destabilization.
22944692 Positional proteomics analysis identifies the cleavage of human eukaryotic translation initiation factor 4A2 (EIF4A2) at amino acid residues 375-376 by the HIV-1 protease
22759308 Positional proteomics analysis identifies the cleavage of human eukaryotic translation initiation factor 4A2 (EIF4A2) at amino acid residues 375-376 by the HIV-1 protease
22589333 The results indicated that eIF4AI and eIF4AII expression are linked and that the two protein isoforms exhibit functional differences.
22360420 A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration.
21427765 Studies indicate that eIF4A (DDX2), together with its accessory proteins eIF4B and eIF4H, is thought to act as a helicase that unwinds secondary structures in the mRNA 5' UTR.
19034380 This protein has been found differentially expressed in the temporal lobe from patients with schizophrenia.
18976975 Knockdown of eukaryotic translation initiation factor 4A2 (EIF4A2) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
More...

AA Sequence

MSGGSADYNREHGGPEGMDPDGVIESNWNEIVDNFDDMNLKESLLRGIYAYGFEKPSAIQQRAIIPCIKG      1 - 70
YDVIAQAQSGTGKTATFAISILQQLEIEFKETQALVLAPTRELAQQIQKVILALGDYMGATCHACIGGTN     71 - 140
VRNEMQKLQAEAPHIVVGTPGRVFDMLNRRYLSPKWIKMFVLDEADEMLSRGFKDQIYEIFQKLNTSIQV    141 - 210
VLLSATMPTDVLEVTKKFMRDPIRILVKKEELTLEGIKQFYINVEREEWKLDTLCDLYETLTITQAVIFL    211 - 280
NTRRKVDWLTEKMHARDFTVSALHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDL    281 - 350
PTNRENYIHRIGRGGRFGRKGVAINFVTEEDKRILRDIETFYNTTVEEMPMNVADLI                 351 - 407
//

Text Mined References (35)

PMID Year Title
26614665 2015 Translational dysregulation in cancer: eIF4A isoforms and sequence determinants of eIF4A dependence.
25416956 2014 A proteome-scale map of the human interactome network.
25277244 2014 The functional landscape of Hsp27 reveals new cellular processes such as DNA repair and alternative splicing and proposes novel anticancer targets.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24105470 2014 A meta-analysis of genome-wide association studies for adiponectin levels in East Asians identifies a novel locus near WDR11-FGFR2.
23867391 2013 Downregulation of EIF4A2 in non-small-cell lung cancer associates with poor prognosis.
23559250 2013 Translational repression and eIF4A2 activity are critical for microRNA-mediated gene regulation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
More...