Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00
PubTator Score 2.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Spontaneous abortion 108
lung cancer 4,466

Expression

  Differential Expression (1)

Disease log2 FC p
lung cancer -1.200 0.006

Synonym

Accession Q14236
Symbols EPAG

Gene

 GO Function (1)

 GO Process (1)

 Compartment GO Term (0)

AA Sequence

MNLYLHPKLWPQLAGTKTLHVADAQRVRKITVHDGIWDAELPRAKRNHSYHLRYHGSSYSRCFLERYRCK      1 - 70
TIGVFRRSNQPDCLETRSEKAKNRDGVVQEKSVRTLFSECVNQCDIRRRPTRFLRMFYHQKHFQLGLKGT     71 - 140
ETEKNERRL                                                                 141 - 149
//

Text Mined References (4)

PMID Year Title
21697133 2011 Full-length transcriptome analysis of human retina-derived cell lines ARPE-19 and Y79 using the vector-capping method.
15772651 2005 The DNA sequence of the human X chromosome.
8133036 1994 Properties of a novel gene isolated from a Hodgkin's disease cell line that is expressed early during lymphoid cell activation.
7736777 1995 The lymphoid proliferation-associated gene EPAG maps to human chromosome region Xq21-->q22.