Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00
PubTator Score 2.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Abortion, Spontaneous 109 0.0 0.0
Disease Target Count
Spontaneous abortion 113
Disease Target Count P-value
lung cancer 4740 5.6e-03

Expression

  Differential Expression (1)

Disease log2 FC p
lung cancer -1.200 5.6e-03

Synonym

Accession Q14236
Symbols EPAG

 GO Function (1)

 GO Process (1)

 Compartment GO Term (0)

AA Sequence

MNLYLHPKLWPQLAGTKTLHVADAQRVRKITVHDGIWDAELPRAKRNHSYHLRYHGSSYSRCFLERYRCK      1 - 70
TIGVFRRSNQPDCLETRSEKAKNRDGVVQEKSVRTLFSECVNQCDIRRRPTRFLRMFYHQKHFQLGLKGT     71 - 140
ETEKNERRL                                                                 141 - 149
//

Text Mined References (4)

PMID Year Title