Property Summary

NCBI Gene PubMed Count 35
PubMed Score 25.66
PubTator Score 13.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count P-value
ovarian cancer 8520 1.3e-07
lung cancer 4740 1.9e-03
glioblastoma 5792 3.6e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Leukodystrophy 55 0.0 4.0
Disease Target Count Z-score Confidence
Retrograde amnesia 5 3.267 1.6
Cerebellar Ataxia 304 3.039 1.5

Expression

  Differential Expression (3)

Disease log2 FC p
glioblastoma 1.100 3.6e-02
lung cancer 1.400 1.9e-03
ovarian cancer -1.700 1.3e-07

Gene RIF (12)

AA Sequence

MDDKELIEYFKSQMKEDPDMASAVAAIRTLLEFLKRDKGETIQGLRANLTSAIETLCGVDSSVAVSSGGE      1 - 70
LFLRFISLASLEYSDYSKCKKIMIERGELFLRRISLSRNKIADLCHTFIKDGATILTHAYSRVVLRVLEA     71 - 140
AVAAKKRFSVYVTESQPDLSGKKMAKALCHLNVPVTVVLDAAVGYIMEKADLVIVGAEGVVENGGIINKI    141 - 210
GTNQMAVCAKAQNKPFYVVAESFKFVRLFPLNQQDVPDKFKYKADTLKVAQTGQDLKEEHPWVDYTAPSL    211 - 280
ITLLFTDLGVLTPSAVSDELIKLYL                                                 281 - 305
//

Text Mined References (39)

PMID Year Title