Property Summary

NCBI Gene PubMed Count 34
Grant Count 6
R01 Count 5
Funding $726,002.01
PubMed Score 23.68
PubTator Score 13.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
glioblastoma 1.100 0.036
lung cancer 1.400 0.002
ovarian cancer 2.400 0.000

Gene RIF (11)

PMID Text
26112719 Oligodendrocytes with truncated or deletion mutants eIF2B showed less tolerable to endoplasmic reticulum stress
21795329 These data emphasize the importance of eIF2Balpha in mediating the eIF2 kinase translation-inhibitory activity and may provide insight into the complex nature of vesiculovirus oncolysis.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19631657 Crystal structure of the alpha subunit of human translation initiation factor 2B.
18632786 Observational study of gene-disease association. (HuGE Navigator)
18330844 The authors suspected VWM and sequenced the genes EIF2B1-5, which revealed one heterozygous mutation in EIF2B4.
18263758 Study reports 9 novel mutations in EIF2B genes in 8 patients, increasing number of known mutations to more than 120. Using homology modeling, analyzed the impact of novel mutations on the 5 subunits of eIF2B protein (alpha, beta, gamma, delta, epsilon)
15776425 analysis of novel mutations in patients with eIF2B-related disorders
14993275 Biochemical analyses indicate that mutations analyzed in eIF2Balpha and -epsilon reduce the steady-state level of the affected subunit, while the most severe mutant tested, eIF2Bbeta(V341D), forms complexes with reduced stability and lower eIF2B activity.
More...

AA Sequence

MDDKELIEYFKSQMKEDPDMASAVAAIRTLLEFLKRDKGETIQGLRANLTSAIETLCGVDSSVAVSSGGE      1 - 70
LFLRFISLASLEYSDYSKCKKIMIERGELFLRRISLSRNKIADLCHTFIKDGATILTHAYSRVVLRVLEA     71 - 140
AVAAKKRFSVYVTESQPDLSGKKMAKALCHLNVPVTVVLDAAVGYIMEKADLVIVGAEGVVENGGIINKI    141 - 210
GTNQMAVCAKAQNKPFYVVAESFKFVRLFPLNQQDVPDKFKYKADTLKVAQTGQDLKEEHPWVDYTAPSL    211 - 280
ITLLFTDLGVLTPSAVSDELIKLYL                                                 281 - 305
//

Text Mined References (38)

PMID Year Title
26112719 2015 Different Eukaryotic Initiation Factor 2B? Mutations Lead to Various Degrees of Intolerance to the Stress of Endoplasmic Reticulum in Oligodendrocytes.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21795329 2011 The alpha subunit of eukaryotic initiation factor 2B (eIF2B) is required for eIF2-mediated translational suppression of vesicular stomatitis virus.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19631657 2009 Crystal structure of the alpha subunit of human translation initiation factor 2B.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
More...