Property Summary

NCBI Gene PubMed Count 12
PubMed Score 47.93
PubTator Score 42.20

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
esophageal adenocarcinoma -3.800 2.2e-02
fibroadenoma 1.800 1.4e-02
lung adenocarcinoma 1.200 1.8e-02
non-small cell lung cancer 2.418 6.8e-08
pancreatic cancer 1.700 5.7e-03
pancreatic ductal adenocarcinoma liver m... 1.883 4.3e-02
psoriasis 1.200 2.0e-24

Gene RIF (4)

AA Sequence

MRTALLLLAALAVATGPALTLRCHVCTSSSNCKHSVVCPASSRFCKTTNTVEPLRGNLVKKDCAESCTPS      1 - 70
YTLQGQVSSGTSSTQCCQEDLCNEKLHNAAPTRTALAHSALSLGLALSLLAVILAPSL                 71 - 128
//

Text Mined References (13)

PMID Year Title