Property Summary

NCBI Gene PubMed Count 12
Grant Count 5
R01 Count 5
Funding $1,657,593
PubMed Score 42.75
PubTator Score 42.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
esophageal adenocarcinoma -3.800 0.022
pancreatic ductal adenocarcinoma liver m... 1.883 0.043
non-small cell lung cancer 2.418 0.000
pancreatic cancer 1.700 0.006
fibroadenoma 1.800 0.014
lung adenocarcinoma 1.200 0.018
psoriasis 1.200 0.000

Gene RIF (4)

PMID Text
26223706 LY6D is the most highly up-regulated in HTR-8/SVneo-SP cells and it has potential to maintain cell proliferation of the cells. it is important for the maintenance of the cells.
23672314 E48 expression was strong and diffuse in non-neoplastic squamous epithelium, and decreased with progression to laryngeal squamous cell carcinoma. Poorly differentiated tumors had fewer E48-positive cells than well- to moderately- differentiated cases.
23075424 induction of LY6D expression is triggered through a pathway regulated by ATM, CHK2 and p53
18187620 Knockdown of lymphocyte antigen 6 complex, locus D (LY6D) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MRTALLLLAALAVATGPALTLRCHVCTSSSNCKHSVVCPASSRFCKTTNTVEPLRGNLVKKDCAESCTPS      1 - 70
YTLQGQVSSGTSSTQCCQEDLCNEKLHNAAPTRTALAHSALSLGLALSLLAVILAPSL                 71 - 128
//

Text Mined References (13)

PMID Year Title
26223706 2016 Up-regulation of lymphocyte antigen 6 complex expression in side-population cells derived from a human trophoblast cell line HTR-8/SVneo.
23672314 2013 Expression of Ep-CAM, but not of E48, associates with nodal involvement in advanced squamous cell carcinomas of the larynx.
23075424 2012 Expression of LY6D is induced at the surface of MCF10A cells by X-ray irradiation.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9551972 1998 Characterization and mapping to human chromosome 8q24.3 of Ly-6-related gene 9804 encoding an apparent homologue of mouse TSA-1.
More...