Property Summary

NCBI Gene PubMed Count 61
Grant Count 103
R01 Count 58
Funding $8,769,368.63
PubMed Score 103.48
PubTator Score 67.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
osteosarcoma -4.295 0.000
glioblastoma 1.300 0.000
group 3 medulloblastoma 1.900 0.000
atypical teratoid / rhabdoid tumor 1.200 0.000
medulloblastoma, large-cell 1.800 0.000
primitive neuroectodermal tumor 1.300 0.007
Atopic dermatitis 1.100 0.000
breast carcinoma 1.100 0.008
adult high grade glioma 1.300 0.000
lung adenocarcinoma 1.700 0.000
inflammatory breast cancer 2.600 0.004
ovarian cancer 1.100 0.000

Synonym

Accession Q14209 B2R9W1 Q7Z6H1 E2F-2
Symbols E2F-2

Gene

PANTHER Protein Class (1)

PDB

1N4M  

Gene RIF (36)

PMID Text
26617764 we validated for the first time that E2F2 acts as a tumor activator in non-small cell lung carcinoma.
26498144 Data indicate that microRNA miR-214 has tumor-suppressive activity in hepatocellular carcinoma (HCC) through inhibition of E2F2 transcription factor (E2F2), cyclin-dependent kinases CDK3 and CDK6.
26474282 E2F2 loss results in increased lung metastasis in breast cancer, potentially functioning through a PTPRD dependent mechanism.
26369285 cell cycle-dependent transcription of the TRAIP gene by E2F1, E2F2, and E2F4 and rapid protein degradation leads to cell cycle-dependent expression with a maximum in G2/M
26012781 Elevated E2F2 expression in glioblastoma cells weakens the effect of elevated levels of miR-218.
25816091 miR218 and miR520a are crucial in the development of hepatocellular carcinoma via the inhibition of cell proliferation and cycle progression by downregulating E2F2.
25647078 Results show evidence that let-7a expression in osteosarcoma (OS) cells is significantly reduced and inversely correlated with E2F2 expression levels and that let-7a plays an important role in OS cell proliferation and tumorigenesis by targeting E2F2.
25362258 miR-31 regulated the proliferation of colon cancer cells by targeting E2F2.
24793496 Overall, miR-155 plays an important role in colorectal carcinoma tumorigenesis by negative regulation of its targets including E2F2.
24446828 E2F2 knockdown can inhibit hESC proliferation and tumorigenicity without significantly harming stemness.
More...

AA Sequence

MLQGPRALASAAGQTPKVVPAMSPTELWPSGLSSPQLCPATATYYTPLYPQTAPPAAAPGTCLDATPHGP      1 - 70
EGQVVRCLPAGRLPAKRKLDLEGIGRPVVPEFPTPKGKCIRVDGLPSPKTPKSPGEKTRYDTSLGLLTKK     71 - 140
FIYLLSESEDGVLDLNWAAEVLDVQKRRIYDITNVLEGIQLIRKKAKNNIQWVGRGMFEDPTRPGKQQQL    141 - 210
GQELKELMNTEQALDQLIQSCSLSFKHLTEDKANKRLAYVTYQDIRAVGNFKEQTVIAVKAPPQTRLEVP    211 - 280
DRTEDNLQIYLKSTQGPIEVYLCPEEVQEPDSPSEEPLPSTSTLCPSPDSAQPSSSTDPSIMEPTASSVP    281 - 350
APAPTPQQAPPPPSLVPLEATDSLLELPHPLLQQTEDQFLSPTLACSSPLISFSPSLDQDDYLWGLEAGE    351 - 420
GISDLFDSYDLGDLLIN                                                         421 - 437
//

Text Mined References (61)

PMID Year Title
26617764 2015 E2F2 induction in related to cell proliferation and poor prognosis in non-small cell lung carcinoma.
26498144 2016 miR-214/199a/199a* cluster levels predict poor survival in hepatocellular carcinoma through interference with cell-cycle regulators.
26474282 2015 Increased metastasis with loss of E2F2 in Myc-driven tumors.
26369285 2015 The TRAF-interacting protein (TRAIP) is a novel E2F target with peak expression in mitosis.
26012781 2015 MiR-218 Inhibited Growth and Metabolism of Human Glioblastoma Cells by Directly Targeting E2F2.
25816091 2015 MicroRNA-218 and microRNA-520a inhibit cell proliferation by downregulating E2F2 in hepatocellular carcinoma.
25647078 2015 Tumor-suppressive microRNA-let-7a inhibits cell proliferation via targeting of E2F2 in osteosarcoma cells.
25362258 2015 miR-31 promotes proliferation of colon cancer cells by targeting E2F2.
24793496 2014 miR-155 regulates the proliferation and cell cycle of colorectal carcinoma cells by targeting E2F2.
24446828 2014 Knockdown of E2F2 inhibits tumorigenicity, but preserves stemness of human embryonic stem cells.
More...