Property Summary

NCBI Gene PubMed Count 70
PubMed Score 107.99
PubTator Score 67.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma 1.300 4.0e-04
Atopic dermatitis 1.100 5.5e-05
atypical teratoid / rhabdoid tumor 1.200 4.9e-07
Breast cancer 1.900 4.2e-06
breast carcinoma 1.100 8.2e-03
glioblastoma 1.100 2.5e-05
group 3 medulloblastoma 1.900 2.4e-05
lung adenocarcinoma 1.700 7.0e-09
medulloblastoma, large-cell 1.800 4.0e-06
osteosarcoma -4.295 2.2e-08
ovarian cancer 1.100 3.4e-08
primitive neuroectodermal tumor 1.300 6.7e-03

Gene RIF (44)

AA Sequence

MLQGPRALASAAGQTPKVVPAMSPTELWPSGLSSPQLCPATATYYTPLYPQTAPPAAAPGTCLDATPHGP      1 - 70
EGQVVRCLPAGRLPAKRKLDLEGIGRPVVPEFPTPKGKCIRVDGLPSPKTPKSPGEKTRYDTSLGLLTKK     71 - 140
FIYLLSESEDGVLDLNWAAEVLDVQKRRIYDITNVLEGIQLIRKKAKNNIQWVGRGMFEDPTRPGKQQQL    141 - 210
GQELKELMNTEQALDQLIQSCSLSFKHLTEDKANKRLAYVTYQDIRAVGNFKEQTVIAVKAPPQTRLEVP    211 - 280
DRTEDNLQIYLKSTQGPIEVYLCPEEVQEPDSPSEEPLPSTSTLCPSPDSAQPSSSTDPSIMEPTASSVP    281 - 350
APAPTPQQAPPPPSLVPLEATDSLLELPHPLLQQTEDQFLSPTLACSSPLISFSPSLDQDDYLWGLEAGE    351 - 420
GISDLFDSYDLGDLLIN                                                         421 - 437
//

Text Mined References (70)

PMID Year Title