Property Summary

NCBI Gene PubMed Count 127
Grant Count 60
R01 Count 40
Funding $5,979,493.4
PubMed Score 101.54
PubTator Score 74.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
group 3 medulloblastoma -1.400 0.000
posterior fossa group B ependymoma -1.300 0.000

Synonym

Accession Q14203 A8MY36 B4DM45 E9PFS5 E9PGE1 G5E9H4 O95296 Q6IQ37 Q9BRM9 Q9UIU1 Q9UIU2
Symbols P135
DP-150
DAP-150

Gene

PDB

2HQH   3E2U   3TQ7   1TXQ   2COY   2HKN   2HKQ   2HL3   2HL5  

 GO Function (1)

Gene RIF (61)

PMID Text
26459637 Data suggest that cargo concentration at ERES is regulated by p150(glued) to coordinate protein sorting and transport carrier formation with the subsequent long-range transport towards the Golgi complex along microtubules.
25774020 Study shows p150glued located at the centrosome in a cell cycle-dependent manner where it is abundant during G1/S phase, located in the minus-end of microtubules during G2/M phase and at the minus-end of microtubules in the mitotic phase.
25763819 The results describe the mutant dynactin p150Glued mouse model of motor neuron disease and show that genetic background influences phenotype in part through a region of chromosome 17 supporting the presence of genetic modifiers.
25558820 DCTN1 mutations linked with neurogeneration on Guam.
25413345 We find that LRRK1-mediated phosphorylation of CLIP-170 causes the accumulation of p150(Glued) (also known as DCTN1) a subunit of dynactin, at microtubule plus ends, thereby facilitating the migration of EGFR-containing endosomes.
25189619 HPS6 interacts with dynactin p150Glued to mediate retrograde trafficking and maturation of lysosomes
25185702 Dynactin functions as both a dynamic tether and brake during dynein-driven motility.
24909165 Taken together, topographic and functional interactions between dynactin, importin-beta and RanBP2 are involved in nuclear translocation of IGF-1R.
24797316 The data of this study showed evidence of both striatal dopaminergic and widespread cortical/subcortical serotonergic dysfunctions in individuals carrying a mutation in the DCTN1 gene.
24676999 The results of this study DCTN1 mutations may contribute to disparate neurodegenerative diagnoses, including familial motor neuron disease, parkinsonism, and frontotemporal atrophy.
More...

AA Sequence

MAQSKRHVYSRTPSGSRMSAEASARPLRVGSRVEVIGKGHRGTVAYVGATLFATGKWVGVILDEAKGKND      1 - 70
GTVQGRKYFTCDEGHGIFVRQSQIQVFEDGADTTSPETPDSSASKVLKREGTDTTAKTSKLRGLKPKKAP     71 - 140
TARKTTTRRPKPTRPASTGVAGASSSLGPSGSASAGELSSSEPSTPAQTPLAAPIIPTPVLTSPGAVPPL    141 - 210
PSPSKEEEGLRAQVRDLEEKLETLRLKRAEDKAKLKELEKHKIQLEQVQEWKSKMQEQQADLQRRLKEAR    211 - 280
KEAKEALEAKERYMEEMADTADAIEMATLDKEMAEERAESLQQEVEALKERVDELTTDLEILKAEIEEKG    281 - 350
SDGAASSYQLKQLEEQNARLKDALVRMRDLSSSEKQEHVKLQKLMEKKNQELEVVRQQRERLQEELSQAE    351 - 420
STIDELKEQVDAALGAEEMVEMLTDRNLNLEEKVRELRETVGDLEAMNEMNDELQENARETELELREQLD    421 - 490
MAGARVREAQKRVEAAQETVADYQQTIKKYRQLTAHLQDVNRELTNQQEASVERQQQPPPETFDFKIKFA    491 - 560
ETKAHAKAIEMELRQMEVAQANRHMSLLTAFMPDSFLRPGGDHDCVLVLLLMPRLICKAELIRKQAQEKF    561 - 630
ELSENCSERPGLRGAAGEQLSFAAGLVYSLSLLQATLHRYEHALSQCSVDVYKKVGSLYPEMSAHERSLD    631 - 700
FLIELLHKDQLDETVNVEPLTKAIKYYQHLYSIHLAEQPEDCTMQLADHIKFTQSALDCMSVEVGRLRAF    701 - 770
LQGGQEATDIALLLRDLETSCSDIRQFCKKIRRRMPGTDAPGIPAALAFGPQVSDTLLDCRKHLTWVVAV    771 - 840
LQEVAAAAAQLIAPLAENEGLLVAALEELAFKASEQIYGTPSSSPYECLRQSCNILISTMNKLATAMQEG    841 - 910
EYDAERPPSKPPPVELRAAALRAEITDAEGLGLKLEDRETVIKELKKSLKIKGEELSEANVRLSLLEKKL    911 - 980
DSAAKDADERIEKVQTRLEETQALLRKKEKEFEETMDALQADIDQLEAEKAELKQRLNSQSKRTIEGLRG    981 - 1050
PPPSGIATLVSGIAGEEQQRGAIPGQAPGSVPGPGLVKDSPLLLQQISAMRLHISQLQHENSILKGAQMK   1051 - 1120
ASLASLPPLHVAKLSHEGPGSELPAGALYRKTSQLLETLNQLSTHTHVVDITRTSPAAKSPSAQLMEQVA   1121 - 1190
QLKSLSDTVEKLKDEVLKETVSQRPGATVPTDFATFPSSAFLRAKEEQQDDTVYMGKVTFSCAAGFGQRH   1191 - 1260
RLVLTQEQLHQLHSRLIS                                                       1261 - 1278
//

Text Mined References (139)

PMID Year Title
26972003 2016 ?-Tubulin Tyrosination and CLIP-170 Phosphorylation Regulate the Initiation of Dynein-Driven Transport in Neurons.
26638075 2015 A Dynamic Protein Interaction Landscape of the Human Centrosome-Cilium Interface.
26459637 2015 A microtubule-independent role of p150glued in secretory cargo concentration at endoplasmic reticulum exit sites.
25774020 2015 Cell Cycle-Dependent Localization of Dynactin Subunit p150 glued at Centrosome.
25763819 2015 Genetic background effects on disease onset and lifespan of the mutant dynactin p150Glued mouse model of motor neuron disease.
25558820 2015 Defining neurodegeneration on Guam by targeted genomic sequencing.
25413345 2015 LRRK1-phosphorylated CLIP-170 regulates EGFR trafficking by recruiting p150Glued to microtubule plus ends.
25189619 2014 HPS6 interacts with dynactin p150Glued to mediate retrograde trafficking and maturation of lysosomes.
25185702 2014 Dynactin functions as both a dynamic tether and brake during dynein-driven motility.
24909165 2015 Nuclear translocation of IGF-1R via p150(Glued) and an importin-?/RanBP2-dependent pathway in cancer cells.
More...