Property Summary

NCBI Gene PubMed Count 21
Grant Count 7
R01 Count 1
Funding $1,542,406
PubMed Score 97.65
PubTator Score 36.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Multiple myeloma 1.762 0.009
glioblastoma 2.000 0.001
ependymoma 1.100 0.000
sonic hedgehog group medulloblastoma 1.500 0.000
atypical teratoid / rhabdoid tumor 1.200 0.000
primitive neuroectodermal tumor 1.200 0.008
primary pancreatic ductal adenocarcinoma 1.044 0.032
colon cancer 3.500 0.002
lung cancer -1.400 0.001
pediatric high grade glioma 1.200 0.000
lung carcinoma -1.600 0.000
Breast cancer -1.400 0.000
acute myeloid leukemia 1.700 0.019
ovarian cancer 2.100 0.000
pituitary cancer -1.300 0.007
Down syndrome 1.400 0.001

Gene RIF (11)

PMID Text
25904053 BTG3 overexpression might reverse the aggressive phenotypes and be employed as a potential target for gene therapy of gastric cancer.
25701359 The suppressed migration and invasion abilities found in BTG3-overexpressing esophageal adenocarcinoma cells. Our findings suggested that BTG3 is suppressor in the progression of esophageal adenocarcinoma
25569101 BTG3 binds and suppresses AKT, a kinase frequently deregulated in cancers.
25238703 Down-regulation of BTG3 promotes cell proliferation, migration and invasion in gastric cancer.
23810394 These results disclosed an important role of BTG3 in lung tumorigenesis.
23657964 BTG3 protein expression may be considered as a good marker to indicate the favorable prognosis of epithelial ovarian carcinoma.
23533280 BTG3-dependent CHK1 ubiquitination contributes to its chromatin localization and activation and a defect in this regulation may increase genome instability and promote tumorigenesis
22020331 loss of BTG3 in normal cells induced cellular senescence, which was correlated with enhanced ERK-AP1 signaling and elevated expression of the histone H3K27me3 demethylase JMJD3/KDM6B
19221000 BTG3 is epigenetically silenced in renal cancer
18590053 These data support the hypothesis that BTG3 may act to suppress tumorigenesis and that hypermethylation is an important mechanism for inactivation of BTG3 and perhaps other tumor suppressor genes.
More...

AA Sequence

MKNEIAAVVFFFTRLVRKHDKLKKEAVERFAEKLTLILQEKYKNHWYPEKPSKGQAYRCIRVNKFQRVDP      1 - 70
DVLKACENSCILYSDLGLPKELTLWVDPCEVCCRYGEKNNAFIVASFENKDENKDEISRKVTRALDKVTS     71 - 140
DYHSGSSSSDEETSKEMEVKPSSVTAAASPVYQISELIFPPLPMWHPLPRKKPGMYRGNGHQNHYPPPVP    141 - 210
FGYPNQGRKNKPYRPIPVTWVPPPGMHCDRNHWINPHMLAPH                                211 - 252
//

Text Mined References (21)

PMID Year Title
25904053 2015 The roles of BTG3 expression in gastric cancer: a potential marker for carcinogenesis and a target molecule for gene therapy.
25701359 2015 BTG3 upregulation induces cell apoptosis and suppresses invasion in esophageal adenocarcinoma.
25569101 2015 Candidate tumor suppressor B-cell translocation gene 3 impedes neoplastic progression by suppression of AKT.
25238703 2015 Down-regulation of BTG3 promotes cell proliferation, migration and invasion and predicts survival in gastric cancer.
23810394 2013 Downregulation of BTG3 in non-small cell lung cancer.
23657964 2013 Decreased expression of BTG3 was linked to carcinogenesis, aggressiveness, and prognosis of ovarian carcinoma.
23533280 2013 Candidate tumor suppressor BTG3 maintains genomic stability by promoting Lys63-linked ubiquitination and activation of the checkpoint kinase CHK1.
22020331 2012 Loss of the candidate tumor suppressor BTG3 triggers acute cellular senescence via the ERK-JMJD3-p16(INK4a) signaling axis.
19221000 2009 BTG3 tumor suppressor gene promoter demethylation, histone modification and cell cycle arrest by genistein in renal cancer.
18590053 2008 Methylation-mediated downregulation of the B-cell translocation gene 3 (BTG3) in breast cancer cells.
More...