Property Summary

NCBI Gene PubMed Count 17
PubMed Score 344.56
PubTator Score 86.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
group 3 medulloblastoma 1.100 3.3e-03
invasive ductal carcinoma 1.100 2.9e-02
lung cancer 1.500 1.0e-04
Multiple myeloma 1.054 5.8e-03
osteosarcoma -1.682 1.9e-04
ovarian cancer 1.500 1.4e-04

Gene RIF (5)

AA Sequence

MAATRCLRWGLSRAGVWLLPPPARCPRRALHKQKDGTEFKSIYSLDKLYPESQGSDTAWRVPNGAKQADS      1 - 70
DIPLDRLTISYCRSSGPGGQNVNKVNSKAEVRFHLATAEWIAEPVRQKIAITHKNKINRLGELILTSESS     71 - 140
RYQFRNLADCLQKIRDMITEASQTPKEPTKEDVKLHRIRIENMNRERLRQKRIHSAVKTSRRVDMD        141 - 206
//

Text Mined References (22)

PMID Year Title