Property Summary

NCBI Gene PubMed Count 13
Grant Count 17
Funding $2,157,532.53
PubMed Score 323.10
PubTator Score 86.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Multiple myeloma 1.054 0.006
osteosarcoma -1.682 0.000
lung cancer 1.500 0.000
group 3 medulloblastoma 1.100 0.003
invasive ductal carcinoma 1.100 0.029
ovarian cancer 1.500 0.000

Gene RIF (2)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
20186120 ICT1 may be essential for hydrolysis of prematurely terminated peptidyl-tRNA moieties in stalled mitoribosomes.

AA Sequence

MAATRCLRWGLSRAGVWLLPPPARCPRRALHKQKDGTEFKSIYSLDKLYPESQGSDTAWRVPNGAKQADS      1 - 70
DIPLDRLTISYCRSSGPGGQNVNKVNSKAEVRFHLATAEWIAEPVRQKIAITHKNKINRLGELILTSESS     71 - 140
RYQFRNLADCLQKIRDMITEASQTPKEPTKEDVKLHRIRIENMNRERLRQKRIHSAVKTSRRVDMD        141 - 206
//

Text Mined References (17)

PMID Year Title
27029019 2016 Human Cells Require Non-stop Ribosome Rescue Activity in Mitochondria.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25278503 2014 Structure of the large ribosomal subunit from human mitochondria.
24352605 2013 Codon-reading specificities of mitochondrial release factors and translation termination at non-standard stop codons.
23908630 2013 Identification and characterization of CHCHD1, AURKAIP1, and CRIF1 as new members of the mammalian mitochondrial ribosome.
22821833 2012 Solution structure and siRNA-mediated knockdown analysis of the mitochondrial disease-related protein C12orf65.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20869366 2010 Solution structure of the catalytic domain of the mitochondrial protein ICT1 that is essential for cell vitality.
20598281 2010 Mutations in C12orf65 in patients with encephalomyopathy and a mitochondrial translation defect.
More...