Property Summary

NCBI Gene PubMed Count 30
Grant Count 7
Funding $306,969.54
PubMed Score 82.70
PubTator Score 36.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
malignant mesothelioma -4.500 0.000
astrocytoma 2.400 0.025
ependymoma 2.100 0.003
oligodendroglioma 2.300 0.001
psoriasis -2.100 0.001
glioblastoma 2.100 0.007
group 3 medulloblastoma 2.900 0.000
medulloblastoma, large-cell 1.800 0.000
primitive neuroectodermal tumor 2.300 0.000
Atopic dermatitis -1.200 0.004
tuberculosis -1.500 0.000
primary pancreatic ductal adenocarcinoma 2.317 0.000
intraductal papillary-mucinous adenoma (... -2.000 0.003
lung cancer 2.400 0.000
colon cancer -2.200 0.008
pancreatic cancer 2.600 0.001
pediatric high grade glioma 1.700 0.000
pilocytic astrocytoma 2.300 0.000
subependymal giant cell astrocytoma 1.327 0.021
lung carcinoma 1.500 0.000
Breast cancer -1.300 0.000
invasive ductal carcinoma -1.200 0.021
ulcerative colitis 1.300 0.001
ovarian cancer 2.200 0.000
pituitary cancer 2.600 0.000

Synonym

Accession Q14195 B3SXQ8 Q93012 DRP-3
Symbols DRP3
ULIP
CRMP4
DRP-3
LCRMP
CRMP-4
ULIP-1

Gene

PANTHER Protein Class (1)

PDB

4BKN   4CNS   4CNT   4CNU  

Gene RIF (15)

PMID Text
25173447 DPYSL3 expression levels inversely correlated with those of VEGF and FAK. Down-regulation of DPYSL3 expression in HCC tissues may serve as a predictive biomarker for HCC after curative resection.
25096402 Expression status of DPYSL3 in gastric cancer tissues may represent a promising biomarker for the malignant behavior of GC.
24914979 structures provide further insight into the effects of medically relevant mutations of the DPYSL-3 gene encoding CRMP-4 and the putative enzymatic activities of CRMPs
24339867 DPYSL3 as pancreatic ductal adenocarcinoma-associated molecule that regulates cell adhesion and migration by stabilization of focal adhesion complex
24011394 Downregulation of MYCN by small interfering RNA (siRNA) increased DPYSL3 levels, while upregulation of MYCN in non-MYCN NB cells decreased DPYSL3 levels.
23568759 study found the association between the rs147541241 variant and amyotrophic lateral scerosis was limited to the French population
22805864 High collapsin response mediator protein 4 expression is associated with liver metastasis in pancreatic cancer.
21179545 CRMP4 is a key physiological substrate of GSK3 in regulating chromosomal alignment and mitotic progression through its effect on spindle microtubules
20977846 Ulip1 was downregulated and HIF1a was upregulated in hypoxic neuroblastoma cells.
20804502 Data show that two genes, LTB4DH and DPYSL3, were confirmed to be candidate genes for the predictor of a good immune response.
More...

AA Sequence

MSYQGKKNIPRITSDRLLIKGGRIVNDDQSFYADIYMEDGLIKQIGDNLIVPGGVKTIEANGKMVIPGGI      1 - 70
DVHTHFQMPYKGMTTVDDFFQGTKAALAGGTTMIIDHVVPEPESSLTEAYEKWREWADGKSCCDYALHVD     71 - 140
ITHWNDSVKQEVQNLIKDKGVNSFMVYMAYKDLYQVSNTELYEIFTCLGELGAIAQVHAENGDIIAQEQT    141 - 210
RMLEMGITGPEGHVLSRPEELEAEAVFRAITIASQTNCPLYVTKVMSKSAADLISQARKKGNVVFGEPIT    211 - 280
ASLGIDGTHYWSKNWAKAAAFVTSPPLSPDPTTPDYINSLLASGDLQLSGSAHCTFSTAQKAIGKDNFTA    281 - 350
IPEGTNGVEERMSVIWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKGRISVGSDSDLVIWDPDAVKIV    351 - 420
SAKNHQSAAEYNIFEGMELRGAPLVVICQGKIMLEDGNLHVTQGAGRFIPCSPFSDYVYKRIKARRKMAD    421 - 490
LHAVPRGMYDGPVFDLTTTPKGGTPAGSARGSPTRPNPPVRNLHQSGFSLSGTQVDEGVRSASKRIVAPP    491 - 560
GGRSNITSLS                                                                561 - 570
//

Text Mined References (34)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25358863 2014 Amino- and carboxyl-terminal domains of Filamin-A interact with CRMP1 to mediate Sema3A signalling.
25173447 2015 Dihydropyrimidinase-like 3 is a putative hepatocellular carcinoma tumor suppressor.
25096402 2014 Dihydropyrimidinase-like 3 facilitates malignant behavior of gastric cancer.
24914979 2014 Crystal structure of human CRMP-4: correction of intensities for lattice-translocation disorder.
24339867 2013 Quantitative proteomic profiling identifies DPYSL3 as pancreatic ductal adenocarcinoma-associated molecule that regulates cell adhesion and migration by stabilization of focal adhesion complex.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24011394 2013 Dihydropyrimidinase-like protein 3 expression is negatively regulated by MYCN and associated with clinical outcome in neuroblastoma.
23568759 2013 A rare motor neuron deleterious missense mutation in the DPYSL3 (CRMP4) gene is associated with ALS.
22805864 2013 Collapsin response mediator protein 4 expression is associated with liver metastasis and poor survival in pancreatic cancer.
More...