Property Summary

NCBI Gene PubMed Count 39
Grant Count 5
Funding $290,002.85
PubMed Score 39.04
PubTator Score 110.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma 1.511 0.001
posterior fossa group B ependymoma -1.500 0.000
atypical teratoid/rhabdoid tumor -1.100 0.016
group 4 medulloblastoma 1.100 0.000
lung carcinoma 2.700 0.000
spina bifida 1.674 0.038

Synonym

Accession Q14194 A0EJG6 Q13024 Q4W5F1 Q96TC8 DRP-1
Symbols DRP1
DRP-1
CRMP-1
DPYSL1
ULIP-3

Gene

PANTHER Protein Class (1)

PDB

4B3Z  

Gene RIF (25)

PMID Text
26598519 These results demonstrate an important role for CRMP-1 in Listeria actin comet tail formation and open the possibility that CRMP-1 controls cell motility by modulating Arp2/3 activation.
26249678 Human CRMP-1 comprises a tetrameric assembly.
26032958 The mitochondrial fragmentation protein DRP1 play a role in the development of malignant melanoma.
26009886 Results show that expression of CRMP1 is downregulated in medulloblastoma (MB) tumors. its overexpression inhibits proliferation, migration and invasion of cells suggesting that CRMP1 is implicated in MB pathogenesis.
25908449 CRMP1 targets aggregation-prone, N-terminal HTT fragments and suppresses their spontaneous self-assembly.
25526860 CRMP1 interacted with Spy1 which would disturb the association of CRMP1 with actin and was involved in the collapse of growth cones induced by Sema3A and regeneration after sciatic nerve crush.
25194153 Aberrant upregulation of CRMP-1 expression may link to the mechanism of developing early-onset preeclampsia.
22798627 CRMP1 is a novel candidate protein for schizophrenia traits
22363707 GSK3beta-dependent phosphorylation of LCRMP-1 provides an important mechanism for regulation of LCRMP-1 on cancer cell invasiveness and clinical outcome.
22359051 in pilocarpine-induced animal model of epilepsy, CRMP-1 dynamically decreased in a range of 2 months. Thus, our results indicate that CRMP-1 may be involved in the development of TLE
More...

AA Sequence

MSYQGKKSIPHITSDRLLIKGGRIINDDQSLYADVYLEDGLIKQIGENLIVPGGVKTIEANGRMVIPGGI      1 - 70
DVNTYLQKPSQGMTAADDFFQGTRAALVGGTTMIIDHVVPEPGSSLLTSFEKWHEAADTKSCCDYSLHVD     71 - 140
ITSWYDGVREELEVLVQDKGVNSFQVYMAYKDVYQMSDSQLYEAFTFLKGLGAVILVHAENGDLIAQEQK    141 - 210
RILEMGITGPEGHALSRPEELEAEAVFRAITIAGRINCPVYITKVMSKSAADIIALARKKGPLVFGEPIA    211 - 280
ASLGTDGTHYWSKNWAKAAAFVTSPPLSPDPTTPDYLTSLLACGDLQVTGSGHCPYSTAQKAVGKDNFTL    281 - 350
IPEGVNGIEERMTVVWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDADVVIWDPDKLKTI    351 - 420
TAKSHKSAVEYNIFEGMECHGSPLVVISQGKIVFEDGNINVNKGMGRFIPRKAFPEHLYQRVKIRNKVFG    421 - 490
LQGVSRGMYDGPVYEVPATPKYATPAPSAKSSPSKHQPPPIRNLHQSNFSLSGAQIDDNNPRRTGHRIVA    491 - 560
PPGGRSNITSLG                                                              561 - 572
//

Text Mined References (43)

PMID Year Title
26598519 2016 Collapsin Response Mediator Protein-1 Regulates Arp2/3-dependent Actin Assembly.
26249678 2015 Structure of human collapsin response mediator protein 1: a possible role of its C-terminal tail.
26032958 2015 Activation of the Mitochondrial Fragmentation Protein DRP1 Correlates with BRAF(V600E) Melanoma.
26009886 2015 CRMP1 Inhibits Proliferation of Medulloblastoma and Is Regulated by HMGA1.
25908449 2015 Systematic interaction network filtering identifies CRMP1 as a novel suppressor of huntingtin misfolding and neurotoxicity.
25526860 2016 CRMP1 Interacted with Spy1 During the Collapse of Growth Cones Induced by Sema3A and Acted on Regeneration After Sciatic Nerve Crush.
25416956 2014 A proteome-scale map of the human interactome network.
25358863 2014 Amino- and carboxyl-terminal domains of Filamin-A interact with CRMP1 to mediate Sema3A signalling.
25194153 2015 Expression of collapsin response mediator protein 1 in placenta of normal gestation and link to early-onset preeclampsia.
24722188 2014 Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism.
More...