| Tbio | Four and a half LIM domains protein 2 |
May function as a molecular transmitter linking various signaling pathways to transcriptional regulation. Negatively regulates the transcriptional repressor E4F1 and may function in cell growth. Inhibits the transcriptional activity of FOXO1 and its apoptotic function by enhancing the interaction of FOXO1 with SIRT1 and FOXO1 deacetylation.
This gene encodes a member of the four-and-a-half-LIM-only protein family. Family members contain two highly conserved, tandemly arranged, zinc finger domains with four highly conserved cysteines binding a zinc atom in each zinc finger. This protein is thought to have a role in the assembly of extracellular membranes. Also, this gene is down-regulated during transformation of normal myoblasts to rhabdomyosarcoma cells and the encoded protein may function as a link between presenilin-2 and an intracellular signaling pathway. Multiple alternatively spliced variants encoding different isoforms have been identified. [provided by RefSeq, Jan 2016]
This gene encodes a member of the four-and-a-half-LIM-only protein family. Family members contain two highly conserved, tandemly arranged, zinc finger domains with four highly conserved cysteines binding a zinc atom in each zinc finger. This protein is thought to have a role in the assembly of extracellular membranes. Also, this gene is down-regulated during transformation of normal myoblasts to rhabdomyosarcoma cells and the encoded protein may function as a link between presenilin-2 and an intracellular signaling pathway. Multiple alternatively spliced variants encoding different isoforms have been identified. [provided by RefSeq, Jan 2016]
Comments
| Disease | Target Count | Z-score | Confidence |
|---|---|---|---|
| Breast Neoplasms | 445 | 0.0 | 0.0 |
| Cardiomegaly | 116 | 0.0 | 0.0 |
| Leukemia, Myeloid, Acute | 105 | 0.0 | 0.0 |
| Liver Cirrhosis, Experimental | 769 | 0.0 | 0.0 |
| Disease | Target Count | P-value |
|---|---|---|
| malignant mesothelioma | 3232 | 1.6e-09 |
| non-small cell lung cancer | 2890 | 1.6e-07 |
| pancreatic cancer | 2398 | 2.9e-05 |
| nasopharyngeal carcinoma | 1058 | 3.9e-05 |
| Breast cancer | 3578 | 4.4e-04 |
| lung adenocarcinoma | 2716 | 4.6e-04 |
| lung cancer | 4740 | 5.7e-04 |
| pituitary cancer | 1972 | 6.0e-04 |
| hepatocellular carcinoma | 547 | 1.1e-03 |
| ovarian cancer | 8520 | 1.2e-03 |
| Pick disease | 1894 | 1.2e-03 |
| astrocytic glioma | 2597 | 2.9e-03 |
| intraductal papillary-mucinous adenoma (IPMA) | 2955 | 4.4e-03 |
| ependymoma | 4679 | 5.7e-03 |
| intraductal papillary-mucinous neoplasm (IPMN) | 3291 | 6.1e-03 |
| oligodendroglioma | 2850 | 8.8e-03 |
| intraductal papillary-mucinous carcinoma (IPMC) | 2989 | 1.0e-02 |
| pancreatic ductal adenocarcinoma liver metastasis | 1962 | 2.0e-02 |
| sonic hedgehog group medulloblastoma | 467 | 2.3e-02 |
| active ulcerative colitis | 764 | 3.5e-02 |
| spina bifida | 1074 | 3.6e-02 |
| adrenocortical carcinoma | 1428 | 3.7e-02 |
| Disease | Target Count | Z-score | Confidence |
|---|---|---|---|
| Hemophagocytic lymphohistiocytosis | 30 | 5.43 | 2.7 |
| Hypothyroidism | 122 | 4.354 | 2.2 |
| Cancer | 2499 | 3.595 | 1.8 |
| Hepatitis A | 11 | 3.217 | 1.6 |
| Hyperthyroidism | 53 | 3.142 | 1.6 |
| Amenorrhea | 58 | 3.099 | 1.5 |
| Ectopic pregnancy | 16 | 3.025 | 1.5 |
| Disease | Target Count |
|---|---|
| Familial isolated dilated cardiomyopathy | 41 |
| Disease | log2 FC | p |
|---|---|---|
| active ulcerative colitis | 1.259 | 3.5e-02 |
| adrenocortical carcinoma | -1.190 | 3.7e-02 |
| astrocytic glioma | -1.900 | 2.9e-03 |
| Breast cancer | -1.500 | 4.4e-04 |
| ependymoma | -2.400 | 5.7e-03 |
| hepatocellular carcinoma | 1.100 | 1.1e-03 |
| intraductal papillary-mucinous adenoma (... | 1.900 | 4.4e-03 |
| intraductal papillary-mucinous carcinoma... | 2.000 | 1.0e-02 |
| intraductal papillary-mucinous neoplasm ... | 2.800 | 6.1e-03 |
| lung adenocarcinoma | 1.400 | 4.6e-04 |
| lung cancer | 2.100 | 5.7e-04 |
| malignant mesothelioma | -3.700 | 1.6e-09 |
| nasopharyngeal carcinoma | -1.300 | 3.9e-05 |
| non-small cell lung cancer | 1.172 | 1.6e-07 |
| oligodendroglioma | -1.900 | 8.8e-03 |
| ovarian cancer | -1.900 | 1.2e-03 |
| pancreatic cancer | 1.800 | 2.9e-05 |
| pancreatic ductal adenocarcinoma liver m... | 1.605 | 2.0e-02 |
| Pick disease | -1.200 | 1.2e-03 |
| pituitary cancer | -1.800 | 6.0e-04 |
| sonic hedgehog group medulloblastoma | 1.400 | 2.3e-02 |
| spina bifida | -1.686 | 3.6e-02 |
MTERFDCHHCNESLFGKKYILREESPYCVVCFETLFANTCEECGKPIGCDCKDLSYKDRHWHEACFHCSQ 1 - 70 CRNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSSWHETCFICHRCQQPIGTKS 71 - 140 FIPKDNQNFCVPCYEKQHAMQCVQCKKPITTGGVTYREQPWHKECFVCTACRKQLSGQRFTARDDFAYCL 141 - 210 NCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDCGKDI 211 - 279 //
