Property Summary

NCBI Gene PubMed Count 100
PubMed Score 355.24
PubTator Score 111.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
malignant mesothelioma 3163 1.62500703738333E-9
non-small cell lung cancer 2798 1.60775902033578E-7
nasopharyngeal carcinoma 1056 3.91780244202245E-5
Breast cancer 3099 4.44798266710913E-4
lung adenocarcinoma 2714 4.56883725144367E-4
lung cancer 4473 5.69567621825914E-4
pituitary cancer 1972 5.99298860734202E-4
hepatocellular carcinoma 550 0.00113540410323898
ovarian cancer 8492 0.00117213424897593
Pick disease 1893 0.00123038777718269
primary pancreatic ductal adenocarcinoma 1271 0.00141477477141436
pancreatic cancer 2300 0.00238722454759654
astrocytic glioma 2241 0.00292530169923861
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00439145348317419
ependymoma 2514 0.00572247851633479
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00611495289504296
oligodendroglioma 2849 0.00877507985623646
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0102644626323335
sonic hedgehog group medulloblastoma 1482 0.0229166626693723
active ulcerative colitis 477 0.0346137642322959
spina bifida 1064 0.0357719956073388
adrenocortical carcinoma 1427 0.036638980852176

Expression

Synonym

Accession Q14192 Q13229 Q13644 Q2I5I4 Q5TM15 Q9P294 FHL-2
Symbols DRAL
AAG11
FHL-2
SLIM3
SLIM-3

Gene

PDB

1X4K   1X4L   2D8Z   2MIU  

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid

Gene RIF (69)

PMID Text
26759260 FHL2 overexpression could contribute to the growth, proliferation, invasiveness, and metastasis of human tongue squamous cell carcinoma.
26759258 FHL2 might interact with Runx2 to mediate mesenchymal cell differentiation at the early stages of tooth development and human dental pulp cell differentiation.
26548523 Studies indicate that the LIM-only protein FHL2 interactome is functionally involved in the cardiovascular system.
26320172 KLF8-induced FHL2 activation is a novel and critical signaling mechanism underlying human colorectal cancer invasion and metastasis.
26222912 These results identify FHL2 as a novel gene associated with asthma severity in human.
26211626 Describe the molecular network governing FHL2 expression, and FHL2-linked cancers and the underlying molecular machinery. Review.
25917075 results provide evidence for the importance of the focal adhesion protein FHL2 in pancreatic cancer cell survival, proliferation and radiosensitivity
25855776 we conclude that FHL2 has both structural and functional protein-protein interactions with b-catenin in the podocyte nucleus and that FHL2 protein inhibition can mitigate Wnt/b-catenin-induced podocytopathy.
25596251 Enhanced FHL2 and TGF-beta1 expression is correlated with poor survival in human malignant melanoma
25554651 Tumoral expression of nuclear cofactor FHL2 is associated with lymphatic metastasis in sporadic but not in hereditary nonpolyposis colorectal cancer-associated colorectal cancer.
More...

AA Sequence

MTERFDCHHCNESLFGKKYILREESPYCVVCFETLFANTCEECGKPIGCDCKDLSYKDRHWHEACFHCSQ      1 - 70
CRNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSSWHETCFICHRCQQPIGTKS     71 - 140
FIPKDNQNFCVPCYEKQHAMQCVQCKKPITTGGVTYREQPWHKECFVCTACRKQLSGQRFTARDDFAYCL    141 - 210
NCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDCGKDI     211 - 279
//

Text Mined References (105)

PMID Year Title
26759260 2016 Four and a half LIM domains 2 contributes to the development of human tongue squamous cell carcinoma.
26759258 2016 FHL2 mediates tooth development and human dental pulp cell differentiation into odontoblasts, partially by interacting with Runx2.
26548523 2016 Protein-protein interactions of the LIM-only protein FHL2 and functional implication of the interactions relevant in cardiovascular disease.
26320172 2015 KLF8 promotes tumorigenesis, invasion and metastasis of colorectal cancer cells by transcriptional activation of FHL2.
26222912 2015 Deficiency of FHL2 attenuates airway inflammation in mice and genetic variation associates with human bronchial hyper-responsiveness.
26211626 2015 The FHL2 regulation in the transcriptional circuitry of human cancers.
25917075 2015 LIM-only protein FHL2 critically determines survival and radioresistance of pancreatic cancer cells.
25855776 2015 Four-and-a-Half LIM Domains Protein 2 Is a Coactivator of Wnt Signaling in Diabetic Kidney Disease.
25596251 2015 Enhanced FHL2 and TGF-?1 Expression Is Associated With Invasive Growth and Poor Survival in Malignant Melanomas.
25554651 2015 Tumoral expression of nuclear cofactor FHL2 is associated with lymphatic metastasis in sporadic but not in HNPCC-associated colorectal cancer.
More...