Property Summary

NCBI Gene PubMed Count 108
PubMed Score 385.78
PubTator Score 111.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (22)

Disease log2 FC p
active ulcerative colitis 1.259 3.5e-02
adrenocortical carcinoma -1.190 3.7e-02
astrocytic glioma -1.900 2.9e-03
Breast cancer -1.500 4.4e-04
ependymoma -2.400 5.7e-03
hepatocellular carcinoma 1.100 1.1e-03
intraductal papillary-mucinous adenoma (... 1.900 4.4e-03
intraductal papillary-mucinous carcinoma... 2.000 1.0e-02
intraductal papillary-mucinous neoplasm ... 2.800 6.1e-03
lung adenocarcinoma 1.400 4.6e-04
lung cancer 2.100 5.7e-04
malignant mesothelioma -3.700 1.6e-09
nasopharyngeal carcinoma -1.300 3.9e-05
non-small cell lung cancer 1.172 1.6e-07
oligodendroglioma -1.900 8.8e-03
ovarian cancer -1.900 1.2e-03
pancreatic cancer 1.800 2.9e-05
pancreatic ductal adenocarcinoma liver m... 1.605 2.0e-02
Pick disease -1.200 1.2e-03
pituitary cancer -1.800 6.0e-04
sonic hedgehog group medulloblastoma 1.400 2.3e-02
spina bifida -1.686 3.6e-02

Gene RIF (74)

AA Sequence

MTERFDCHHCNESLFGKKYILREESPYCVVCFETLFANTCEECGKPIGCDCKDLSYKDRHWHEACFHCSQ      1 - 70
CRNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSSWHETCFICHRCQQPIGTKS     71 - 140
FIPKDNQNFCVPCYEKQHAMQCVQCKKPITTGGVTYREQPWHKECFVCTACRKQLSGQRFTARDDFAYCL    141 - 210
NCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDCGKDI     211 - 279
//

Text Mined References (113)

PMID Year Title