Tbio | Four and a half LIM domains protein 2 |
May function as a molecular transmitter linking various signaling pathways to transcriptional regulation. Negatively regulates the transcriptional repressor E4F1 and may function in cell growth. Inhibits the transcriptional activity of FOXO1 and its apoptotic function by enhancing the interaction of FOXO1 with SIRT1 and FOXO1 deacetylation.
This gene encodes a member of the four-and-a-half-LIM-only protein family. Family members contain two highly conserved, tandemly arranged, zinc finger domains with four highly conserved cysteines binding a zinc atom in each zinc finger. This protein is thought to have a role in the assembly of extracellular membranes. Also, this gene is down-regulated during transformation of normal myoblasts to rhabdomyosarcoma cells and the encoded protein may function as a link between presenilin-2 and an intracellular signaling pathway. Multiple alternatively spliced variants encoding different isoforms have been identified. [provided by RefSeq, Jan 2016]
This gene encodes a member of the four-and-a-half-LIM-only protein family. Family members contain two highly conserved, tandemly arranged, zinc finger domains with four highly conserved cysteines binding a zinc atom in each zinc finger. This protein is thought to have a role in the assembly of extracellular membranes. Also, this gene is down-regulated during transformation of normal myoblasts to rhabdomyosarcoma cells and the encoded protein may function as a link between presenilin-2 and an intracellular signaling pathway. Multiple alternatively spliced variants encoding different isoforms have been identified. [provided by RefSeq, Jan 2016]
Comments
Disease | Target Count |
---|---|
Leukemia, Myelocytic, Acute | 113 |
Mammary Neoplasms | 410 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Hemophagocytic lymphohistiocytosis | 30 | 5.288 | 2.6 |
Hypothyroidism | 89 | 4.198 | 2.1 |
Cancer | 2346 | 3.544 | 1.8 |
Amenorrhea | 60 | 3.128 | 1.6 |
Hyperthyroidism | 50 | 3.051 | 1.5 |
Hepatitis A | 10 | 3.031 | 1.5 |
Hepatitis B | 103 | 3.03 | 1.5 |
Disease | Target Count |
---|---|
Familial isolated dilated cardiomyopathy | 41 |
Disease | log2 FC | p |
---|---|---|
hepatocellular carcinoma | 1.100 | 0.001 |
malignant mesothelioma | -3.700 | 0.000 |
astrocytic glioma | -1.900 | 0.003 |
ependymoma | -2.400 | 0.006 |
oligodendroglioma | -1.900 | 0.009 |
adrenocortical carcinoma | -1.190 | 0.037 |
primary pancreatic ductal adenocarcinoma | 3.063 | 0.001 |
non-small cell lung cancer | 1.172 | 0.000 |
intraductal papillary-mucinous adenoma (... | 1.900 | 0.004 |
intraductal papillary-mucinous carcinoma... | 2.000 | 0.010 |
intraductal papillary-mucinous neoplasm ... | 2.800 | 0.006 |
lung cancer | 2.100 | 0.001 |
active ulcerative colitis | 1.259 | 0.035 |
pancreatic cancer | 2.500 | 0.002 |
sonic hedgehog group medulloblastoma | 1.400 | 0.023 |
lung adenocarcinoma | 1.400 | 0.000 |
nasopharyngeal carcinoma | -1.300 | 0.000 |
spina bifida | -1.686 | 0.036 |
Pick disease | -1.200 | 0.001 |
Breast cancer | -1.500 | 0.000 |
ovarian cancer | -1.900 | 0.001 |
pituitary cancer | -1.800 | 0.001 |
Species | Source |
---|---|
Chimp | OMA EggNOG |
Macaque | OMA Inparanoid |
Mouse | OMA Inparanoid |
Rat | OMA Inparanoid |
Dog | OMA Inparanoid |
Horse | OMA Inparanoid |
Cow | OMA Inparanoid |
Opossum | OMA Inparanoid |
Chicken | OMA Inparanoid |
Anole lizard | OMA Inparanoid |
Xenopus | OMA Inparanoid |
Zebrafish | OMA Inparanoid |
PMID | Text |
---|---|
26759260 | FHL2 overexpression could contribute to the growth, proliferation, invasiveness, and metastasis of human tongue squamous cell carcinoma. |
26759258 | FHL2 might interact with Runx2 to mediate mesenchymal cell differentiation at the early stages of tooth development and human dental pulp cell differentiation. |
26548523 | Studies indicate that the LIM-only protein FHL2 interactome is functionally involved in the cardiovascular system. |
26320172 | KLF8-induced FHL2 activation is a novel and critical signaling mechanism underlying human colorectal cancer invasion and metastasis. |
26222912 | These results identify FHL2 as a novel gene associated with asthma severity in human. |
26211626 | Describe the molecular network governing FHL2 expression, and FHL2-linked cancers and the underlying molecular machinery. Review. |
25917075 | results provide evidence for the importance of the focal adhesion protein FHL2 in pancreatic cancer cell survival, proliferation and radiosensitivity |
25855776 | we conclude that FHL2 has both structural and functional protein-protein interactions with b-catenin in the podocyte nucleus and that FHL2 protein inhibition can mitigate Wnt/b-catenin-induced podocytopathy. |
25596251 | Enhanced FHL2 and TGF-beta1 expression is correlated with poor survival in human malignant melanoma |
25554651 | Tumoral expression of nuclear cofactor FHL2 is associated with lymphatic metastasis in sporadic but not in hereditary nonpolyposis colorectal cancer-associated colorectal cancer. |
More... |
MTERFDCHHCNESLFGKKYILREESPYCVVCFETLFANTCEECGKPIGCDCKDLSYKDRHWHEACFHCSQ 1 - 70 CRNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSSWHETCFICHRCQQPIGTKS 71 - 140 FIPKDNQNFCVPCYEKQHAMQCVQCKKPITTGGVTYREQPWHKECFVCTACRKQLSGQRFTARDDFAYCL 141 - 210 NCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDCGKDI 211 - 279 //
PMID | Year | Title |
---|---|---|
26759260 | 2016 | Four and a half LIM domains 2 contributes to the development of human tongue squamous cell carcinoma. |
26759258 | 2016 | FHL2 mediates tooth development and human dental pulp cell differentiation into odontoblasts, partially by interacting with Runx2. |
26548523 | 2016 | Protein-protein interactions of the LIM-only protein FHL2 and functional implication of the interactions relevant in cardiovascular disease. |
26320172 | 2015 | KLF8 promotes tumorigenesis, invasion and metastasis of colorectal cancer cells by transcriptional activation of FHL2. |
26222912 | 2015 | Deficiency of FHL2 attenuates airway inflammation in mice and genetic variation associates with human bronchial hyper-responsiveness. |
26211626 | 2015 | The FHL2 regulation in the transcriptional circuitry of human cancers. |
25917075 | 2015 | LIM-only protein FHL2 critically determines survival and radioresistance of pancreatic cancer cells. |
25855776 | 2015 | Four-and-a-Half LIM Domains Protein 2 Is a Coactivator of Wnt Signaling in Diabetic Kidney Disease. |
25596251 | 2015 | Enhanced FHL2 and TGF-?1 Expression Is Associated With Invasive Growth and Poor Survival in Malignant Melanomas. |
25554651 | 2015 | Tumoral expression of nuclear cofactor FHL2 is associated with lymphatic metastasis in sporadic but not in HNPCC-associated colorectal cancer. |
More... |