Property Summary

NCBI Gene PubMed Count 282
PubMed Score 569.70
PubTator Score 487.79

Knowledge Summary


No data available


  Disease (7)

Disease Target Count Z-score Confidence
Werner syndrome 29 9.007 4.0
Aging, Premature 4 0.0 0.0
Disease Target Count P-value
sonic hedgehog group medulloblastoma 467 3.7e-07
medulloblastoma, large-cell 6241 3.9e-05
psoriasis 6694 1.7e-04
lung cancer 4740 6.1e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Kidney cancer 2613 0.0 0.7
Disease Target Count Z-score Confidence
Heart disease 306 0.0 0.9
Disease Target Count Z-score Confidence
Prostate cancer 175 0.0 5.0


  Differential Expression (6)

Disease log2 FC p
diabetes mellitus -1.100 1.5e-03
osteosarcoma -2.396 1.5e-04
lung cancer 1.100 6.1e-03
medulloblastoma, large-cell 1.400 3.9e-05
psoriasis -1.500 1.7e-04
sonic hedgehog group medulloblastoma 1.600 3.7e-07

 OMIM Phenotype (1)

Protein-protein Interaction (1)

Gene RIF (242)

AA Sequence

AERKRRLPVWFAKGSDTSKKLMDKTKRGGLFS                                         1401 - 1432

Text Mined References (297)

PMID Year Title