Property Summary

NCBI Gene PubMed Count 262
Grant Count 418
R01 Count 209
Funding $66,871,517.78
PubMed Score 551.65
PubTator Score 487.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis -1.500 0.000
osteosarcoma -2.396 0.000
medulloblastoma, large-cell 1.400 0.000
lung cancer 1.100 0.006
diabetes mellitus -1.100 0.001
sonic hedgehog group medulloblastoma 1.600 0.000

Synonym

Accession Q14191 A1KYY9
Symbols RECQ3
RECQL2
RECQL3

Gene

WRN

PDB

2AXL   2DGZ   2E1E   2E1F   2FBT   2FBV   2FBX   2FBY   2FC0   3AAF  

MLP Assay (3)

AID Type Active / Inconclusive / Inactive Description
651767 summary 0 / 0 / 0 qHTS for Inhibitors of WRN Helicase: Summary
651768 confirmatory 1678 / 6342 / 356305 qHTS for Inhibitors of WRN Helicase
720497 confirmatory 384 / 118 / 109 qHTS for Inhibitors of WRN Helicase: Confirmatory Assay for Cherry-picked Compounds.

Gene RIF (228)

PMID Text
26808708 we provide a proof of concept for applying the external guide sequence (EGS) approach in directing an RNase P RNA to efficiently cleave the WRN mRNA in cultured human cell lines.
26695548 Finfings indicate a role for Werner syndrome helicase WRN as a modulator of DNA repair, replication, and recombination.
26690424 The CC genotype of WRN rs1346044 may contribute to an increased risk and a premature onset of breast cancer.
26420422 WRN prefers to act on DNA strand invasion intermediates in a manner that favours strand invasion and exchange.
26394601 We found statistically significant association with AAO for three genes (WRN, NTN4 and LAMC3) with common associated variants.
26391948 PARylation is involved in the recruitment of RECQL5 and WRN to laser-induced DNA damage and RECQL5 and WRN have differential responses to PARylated PARP1 and Poly(ADP-ribose).
26241669 Multiplex genetic testing of 90 cancer susceptibility genes disclosed a novel WRN frameshift mutation (p.N1370Tfs*23) in a mother and her 2 daughters with cancer and in the youngest unaffected daughter.
26037922 knockdown of WRN reduced TNF-alpha stimulation-induced activation of the endogenous promoter of IL-8, an NF-kappaB-responsive gene, and WRN increased its association with the IL-8 promoter region together with RelA/p50 after TNF-alpha stimulation
25801465 Data indicate that Werner syndrome helicase (WRN)-mediated DNA repair is regulated by SIRT1 deacetylase.
25730140 WRN knockdown decreased the G(O):A-induced A:T --> C:G mutations, suggesting that WRN may enhance the mutations caused by G(O) in the nucleotide pool
More...

AA Sequence

MSEKKLETTAQQRKCPEWMNVQNKRCAVEERKACVRKSVFEDDLPFLEFTGSIVYSYDASDCSFLSEDIS      1 - 70
MSLSDGDVVGFDMEWPPLYNRGKLGKVALIQLCVSESKCYLFHVSSMSVFPQGLKMLLENKAVKKAGVGI     71 - 140
EGDQWKLLRDFDIKLKNFVELTDVANKKLKCTETWSLNSLVKHLLGKQLLKDKSIRCSNWSKFPLTEDQK    141 - 210
LYAATDAYAGFIIYRNLEILDDTVQRFAINKEEEILLSDMNKQLTSISEEVMDLAKHLPHAFSKLENPRR    211 - 280
VSILLKDISENLYSLRRMIIGSTNIETELRPSNNLNLLSFEDSTTGGVQQKQIREHEVLIHVEDETWDPT    281 - 350
LDHLAKHDGEDVLGNKVERKEDGFEDGVEDNKLKENMERACLMSLDITEHELQILEQQSQEEYLSDIAYK    351 - 420
STEHLSPNDNENDTSYVIESDEDLEMEMLKHLSPNDNENDTSYVIESDEDLEMEMLKSLENLNSGTVEPT    421 - 490
HSKCLKMERNLGLPTKEEEEDDENEANEGEEDDDKDFLWPAPNEEQVTCLKMYFGHSSFKPVQWKVIHSV    491 - 560
LEERRDNVAVMATGYGKSLCFQYPPVYVGKIGLVISPLISLMEDQVLQLKMSNIPACFLGSAQSENVLTD    561 - 630
IKLGKYRIVYVTPEYCSGNMGLLQQLEADIGITLIAVDEAHCISEWGHDFRDSFRKLGSLKTALPMVPIV    631 - 700
ALTATASSSIREDIVRCLNLRNPQITCTGFDRPNLYLEVRRKTGNILQDLQPFLVKTSSHWEFEGPTIIY    701 - 770
CPSRKMTQQVTGELRKLNLSCGTYHAGMSFSTRKDIHHRFVRDEIQCVIATIAFGMGINKADIRQVIHYG    771 - 840
APKDMESYYQEIGRAGRDGLQSSCHVLWAPADINLNRHLLTEIRNEKFRLYKLKMMAKMEKYLHSSRCRR    841 - 910
QIILSHFEDKQVQKASLGIMGTEKCCDNCRSRLDHCYSMDDSEDTSWDFGPQAFKLLSAVDILGEKFGIG    911 - 980
LPILFLRGSNSQRLADQYRRHSLFGTGKDQTESWWKAFSRQLITEGFLVEVSRYNKFMKICALTKKGRNW    981 - 1050
LHKANTESQSLILQANEELCPKKLLLPSSKTVSSGTKEHCYNQVPVELSTEKKSNLEKLYSYKPCDKISS   1051 - 1120
GSNISKKSIMVQSPEKAYSSSQPVISAQEQETQIVLYGKLVEARQKHANKMDVPPAILATNKILVDMAKM   1121 - 1190
RPTTVENVKRIDGVSEGKAAMLAPLLEVIKHFCQTNSVQTDLFSSTKPQEEQKTSLVAKNKICTLSQSMA   1191 - 1260
ITYSLFQEKKMPLKSIAESRILPLMTIGMHLSQAVKAGCPLDLERAGLTPEVQKIIADVIRNPPVNSDMS   1261 - 1330
KISLIRMLVPENIDTYLIHMAIEILKHGPDSGLQPSCDVNKRRCFPGSEEICSSSKRSKEEVGINTETSS   1331 - 1400
AERKRRLPVWFAKGSDTSKKLMDKTKRGGLFS                                         1401 - 1432
//

Text Mined References (276)

PMID Year Title
26808708 2016 Targeted inhibition of WRN helicase by external guide sequence and RNase P RNA.
26695548 2016 Replication stress induced site-specific phosphorylation targets WRN to the ubiquitin-proteasome pathway.
26690424 2015 Association of the rs1346044 Polymorphism of the Werner Syndrome Gene RECQL2 with Increased Risk and Premature Onset of Breast Cancer.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26420422 2015 The DNA structure and sequence preferences of WRN underlie its function in telomeric recombination events.
26394601 2015 Family-based genome scan for age at onset of late-onset Alzheimer's disease in whole exome sequencing data.
26391948 2015 Differential and Concordant Roles for Poly(ADP-Ribose) Polymerase 1 and Poly(ADP-Ribose) in Regulating WRN and RECQL5 Activities.
26241669 2015 A Novel WRN Frameshift Mutation Identified by Multiplex Genetic Testing in a Family with Multiple Cases of Cancer.
26037922 2015 The Werner Protein Acts as a Coactivator of Nuclear Factor ?B (NF-?B) on HIV-1 and Interleukin-8 (IL-8) Promoters.
25801465 2015 WRN translocation from nucleolus to nucleoplasm is regulated by SIRT1 and required for DNA repair and the development of chemoresistance.
More...