Property Summary

NCBI Gene PubMed Count 41
Grant Count 43
R01 Count 25
Funding $4,945,747.49
PubMed Score 75.80
PubTator Score 71.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Gene RIF (22)

PMID Text
25319570 In SH-SY5Y cells, ethanol exposure increased Sim2 expression in a manner similar to that of cleaved caspase 3. PKA activation was required for this. Sim2 might be involved in activating caspase 3 and ethanol-induced apoptosis in SH-SY5Y cells.
24909296 Data showed that SIM2 was highly expressed in human glioma tumors and cell lines and its short form might increase the invasion of glioma cells through the alteration of epithelial-mesenchymal transition.
24814368 Data suggest selected SIM1 variants exhibit poor dimerization with ARNT2 (aryl-hydrocarbon receptor nuclear translocator 2) and anomalous intracellular localization; data were used to predict spot in SIM1/SIM2 (residues 290-326) critical in function.
24690990 a single peptide containing multiple SIM2 epitopes can be used to induce both a CD4 and CD8 T cell response, providing a peptide-based vaccine formulation for potential use in immunotherapy of various cancers.
24162743 miR-200a is downregulated in human glioma and inhibition of miR-200a caused upregulation of SIM2-s in T98G cells and promoted their motility.
23343470 Altered expression of SIM2 and ETS2 could be one of the reasons for variable occurrence of different malignant conditions in Down syndrome.
22777354 role for SIM2s in promoting human breast tumor differentiation and maintaining epithelial integrity.
22174909 These results suggest an involvement of SIM2 in key traits of prostate tumor cell biology.
22048266 Significantly lower frequency of SIM2 C-G haplotype (rs2073601-rs2073416) was noticed in individuals with Down syndrome (P value =0.01669) and their fathers (P value=0.01185)
20137643 Genetic variants of SIM2 gene may not be associated with the susceptibility to congenital scoliosis and different clinical phenotypes of CS in Chinese Han population.
More...

AA Sequence

MKEKSKNAAKTRREKENGEFYELAKLLPLPSAITSQLDKASIIRLTTSYLKMRAVFPEGLGDAWGQPSRA      1 - 70
GPLDGVAKELGSHLLQTLDGFVFVVASDGKIMYISETASVHLGLSQVELTGNSIYEYIHPSDHDEMTAVL     71 - 140
TAHQPLHHHLLQEYEIERSFFLRMKCVLAKRNAGLTCSGYKVIHCSGYLKIRQYMLDMSLYDSCYQIVGL    141 - 210
VAVGQSLPPSAITEIKLYSNMFMFRASLDLKLIFLDSRVTEVTGYEPQDLIEKTLYHHVHGCDVFHLRYA    211 - 280
HHLLLVKGQVTTKYYRLLSKRGGWVWVQSYATVVHNSRSSRPHCIVSVNYVLTEIEYKELQLSLEQVSTA    281 - 350
KSQDSWRTALSTSQETRKLVKPKNTKMKTKLRTNPYPPQQYSSFQMDKLECGQLGNWRASPPASAAAPPE    351 - 420
LQPHSESSDLLYTPSYSLPFSYHYGHFPLDSHVFSSKKPMLPAKFGQPQGSPCEVARFFLSTLPASGECQ    421 - 490
WHYANPLVPSSSSPAKNPPEPPANTARHSLVPSYEAPAAAVRRFGEDTAPPSFPSCGHYREEPALGPAKA    491 - 560
ARQAARDGARLALARAAPECCAPPTPEAPGAPAQLPFVLLNYHRVLARRGPLGGAAPAASGLACAPGGPE    561 - 630
AATGALRLRHPSPAATSPPGAPLPHYLGASVIITNGR                                     631 - 667
//

Text Mined References (43)

PMID Year Title
25319570 2015 Ethanol Activation of PKA Mediates Single-Minded 2 Expression in Neuronal Cells.
24909296 2014 Targeting SIM2-s decreases glioma cell invasion through mesenchymal--epithelial transition.
24814368 2014 Characterization of human variants in obesity-related SIM1 protein identifies a hot-spot for dimerization with the partner protein ARNT2.
24690990 2014 Immunization with a peptide containing MHC class I and II epitopes derived from the tumor antigen SIM2 induces an effective CD4 and CD8 T-cell response.
24388013 2014 Genome-wide association analysis identifies 11 risk variants associated with the asthma with hay fever phenotype.
24162743 2014 MiR-200a impairs glioma cell growth, migration, and invasion by targeting SIM2-s.
23343470 2013 Potential contribution of SIM2 and ETS2 functional polymorphisms in Down syndrome associated malignancies.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22777354 2013 Regulation of DCIS to invasive breast cancer progression by Singleminded-2s (SIM2s).
22174909 2011 The role of the transcription factor SIM2 in prostate cancer.
More...