Property Summary

NCBI Gene PubMed Count 53
PubMed Score 42.34
PubTator Score 112.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Arthritis, Juvenile 126 0.0 0.0
Disease Target Count
Juvenile arthritis 126
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Cancer 2499 3.035 1.5

Expression

  Differential Expression (10)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 3.9e-03
colon cancer 1.300 3.6e-02
dermatomyositis -1.100 1.7e-03
group 3 medulloblastoma 1.100 1.2e-02
intraductal papillary-mucinous neoplasm ... 1.700 2.6e-02
lung adenocarcinoma 1.031 3.7e-04
medulloblastoma, large-cell 1.400 1.9e-03
osteosarcoma -2.741 2.9e-05
ovarian cancer 2.000 2.3e-04
psoriasis 1.100 5.8e-14

Protein-protein Interaction (7)

Gene RIF (18)

AA Sequence

MAKDAGLIEANGELKVFIDQNLSPGKGVVSLVAVHPSTVNPLGKQLLPKTFGQSNVNIAQQVVIGTPQRP      1 - 70
AASNTLVVGSPHTPSTHFASQNQPSDSSPWSAGKRNRKGEKNGKGLRHFSMKVCEKVQRKGTTSYNEVAD     71 - 140
ELVAEFSAADNHILPNESAYDQKNIRRRVYDALNVLMAMNIISKEKKEIKWIGLPTNSAQECQNLEVERQ    141 - 210
RRLERIKQKQSQLQELILQQIAFKNLVQRNRHAEQQASRPPPPNSVIHLPFIIVNTSKKTVIDCSISNDK    211 - 280
FEYLFNFDNTFEIHDDIEVLKRMGMACGLESGSCSAEDLKMARSLVPKALEPYVTEMAQGTVGGVFITTA    281 - 350
GSTSNGTRFSASDLTNGADGMLATSSNGSQYSGSRVETPVSYVGEDDEEDDDFNENDEDD              351 - 410
//

Text Mined References (63)

PMID Year Title