Property Summary

NCBI Gene PubMed Count 47
Grant Count 96
R01 Count 47
Funding $19,287,648.6
PubMed Score 40.81
PubTator Score 112.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma -2.741 0.000
atypical teratoid / rhabdoid tumor 1.200 0.004
medulloblastoma, large-cell 1.400 0.002
intraductal papillary-mucinous neoplasm ... 1.700 0.026
colon cancer 1.300 0.036
group 3 medulloblastoma 1.300 0.006
lung adenocarcinoma 1.031 0.000
psoriasis 1.100 0.000
ovarian cancer 2.000 0.000
dermatomyositis -1.100 0.002

Synonym

Accession Q14186 B4DLQ9 Q5JSB4 Q8IZL5
Symbols DP1
DILC
Dp-1
DRTF1

Gene

PANTHER Protein Class (1)

PDB

2AZE  

Gene RIF (14)

PMID Text
26684807 Amplification of CUL4A, IRS2, and TFDP1 genes showed a significant difference in disease-free survival by both univariate and multivariate survival analyses in intrahepatic cholangiocarcinoma.
25133581 The TFDP1 indel84 mutation generates a gain-of-function phenotype by increasing cell proliferation, migration, and invasion of colorectal cancer cells.
23934193 somatic mutations in DP-1 uncouple normal control of the E2F pathway, and thus define a new mechanism that could contribute to aberrant proliferation in tumor cells
21715488 The authors demonstrate that adenovirus E1A binds to E2F/DP-1 complexes through a direct interaction with DP-1 and may selectively activate a subset of E2F-regulated cellular genes during infection.
20513349 the DP-1 "Stabilon" domain was a C-terminal acidic motif and was quite important for DP-1 stability.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19995430 13q34 amplification may be of relevance in tumor progression of breast cancers by inducing overexpression of CUL4A and TFDP1, important in cell cycle regulation. These genes were also overexpressed in non-basal-like tumor samples.
19738611 Observational study of gene-disease association. (HuGE Navigator)
18687693 SOCS-3 acts as a negative regulator of the cell cycle progression under E2F/DP-1 control by interfering with heterodimer formation between DP-1 and E2F
16135794 DP1 is a critical direct target of ARF.
More...

AA Sequence

MAKDAGLIEANGELKVFIDQNLSPGKGVVSLVAVHPSTVNPLGKQLLPKTFGQSNVNIAQQVVIGTPQRP      1 - 70
AASNTLVVGSPHTPSTHFASQNQPSDSSPWSAGKRNRKGEKNGKGLRHFSMKVCEKVQRKGTTSYNEVAD     71 - 140
ELVAEFSAADNHILPNESAYDQKNIRRRVYDALNVLMAMNIISKEKKEIKWIGLPTNSAQECQNLEVERQ    141 - 210
RRLERIKQKQSQLQELILQQIAFKNLVQRNRHAEQQASRPPPPNSVIHLPFIIVNTSKKTVIDCSISNDK    211 - 280
FEYLFNFDNTFEIHDDIEVLKRMGMACGLESGSCSAEDLKMARSLVPKALEPYVTEMAQGTVGGVFITTA    281 - 350
GSTSNGTRFSASDLTNGADGMLATSSNGSQYSGSRVETPVSYVGEDDEEDDDFNENDEDD              351 - 410
//

Text Mined References (57)

PMID Year Title
26684807 2015 Recurrent Amplification at 13q34 Targets at CUL4A, IRS2, and TFDP1 As an Independent Adverse Prognosticator in Intrahepatic Cholangiocarcinoma.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25416956 2014 A proteome-scale map of the human interactome network.
25133581 2014 Next-generation sequencing of colorectal cancers in chinese: identification of a recurrent frame-shift and gain-of-function Indel mutation in the TFDP1 gene.
23934193 2014 Pleiotropic effect of somatic mutations in the E2F subunit DP-1 gene in human cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22773187 2012 Dual functions of DP1 promote biphasic Wnt-on and Wnt-off states during anteroposterior neural patterning.
22327218 2012 Arginine methylation controls growth regulation by E2F-1.
21715488 2011 Adenovirus E1A directly targets the E2F/DP-1 complex.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...