Property Summary

NCBI Gene PubMed Count 60
Grant Count 89
R01 Count 58
Funding $6,514,536.79
PubMed Score 79.09
PubTator Score 67.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma 1.161 0.032
atypical teratoid / rhabdoid tumor 1.800 0.000
glioblastoma 1.300 0.000
group 3 medulloblastoma -1.400 0.009
pilocytic astrocytoma 1.400 0.000
acute myeloid leukemia -2.300 0.007
Breast cancer -1.300 0.000

Synonym

Accession Q14185 A9Z1Z5
Symbols ced5
DOCK180

Gene

PDB

3L4C  

Gene RIF (35)

PMID Text
25586182 Thus, Elmo1 and Dock180 facilitate blood vessel formation by stabilization of the endothelium during angiogenesis.
24819662 High DOCK180 expression is associated with serous ovarian cancer.
23728337 our findings describe a novel mechanism by which EGFRvIII drives glioma tumorigenesis and invasion through protein kinase A-dependent phosphorylation of Dock180
23592719 DOCK1-Rac signaling as an HER2 effector pathway essential for HER2-mediated breast cancer progression to metastasis.
23591873 findings indicate that a chemokine-controlled pathway, consisting of Galphai2, ELMO1/Dock180, Rac1 and Rac2, regulates the actin cytoskeleton during breast cancer metastasis
23314417 Dock180 could act as a pro-survival molecule in H9C2 cardiomyocytes via activation of its downstream pro-survival signaling molecule, AKT.
23239367 Solved is the solution structure of DOCK180 SH3 domain, which shares similar target binding features with the SH3 domain of DOCK2.
22323579 EGFRvIII (also known as DeltaEGFR and de2-7EGFR), a constitutively active EGFR mutant that is frequently co-overexpressed with EGFR in human glioblastoma, promotes tumorigenesis through Src family kinase (SFK)-dependent phosphorylation of Dock180
22175896 Dock180 contributes to ovarian carcinogenesis and dissemination
22080864 Phosphorylation of Dock180(Y1811) enhanced its association with CrkII & p130(Cas). Dock180 associated with PDGFRalpha to promote cell migration. Phosphorylated Dock180(Y1811) contributes to activation of Rac1 in human cancers with PDGFRA amplification.
More...

AA Sequence

MTRWVPTKREEKYGVAFYNYDARGADELSLQIGDTVHILETYEGWYRGYTLRKKSKKGIFPASYIHLKEA      1 - 70
IVEGKGQHETVIPGDLPLIQEVTTTLREWSTIWRQLYVQDNREMFRSVRHMIYDLIEWRSQILSGTLPQD     71 - 140
ELKELKKKVTAKIDYGNRILDLDLVVRDEDGNILDPELTSTISLFRAHEIASKQVEERLQEEKSQKQNID    141 - 210
INRQAKFAATPSLALFVNLKNVVCKIGEDAEVLMSLYDPVESKFISENYLVRWSSSGLPKDIDRLHNLRA    211 - 280
VFTDLGSKDLKREKISFVCQIVRVGRMELRDNNTRKLTSGLRRPFGVAVMDVTDIINGKVDDEDKQHFIP    281 - 350
FQPVAGENDFLQTVINKVIAAKEVNHKGQGLWVTLKLLPGDIHQIRKEFPHLVDRTTAVARKTGFPEIIM    351 - 420
PGDVRNDIYVTLVQGDFDKGSKTTAKNVEVTVSVYDEDGKRLEHVIFPGAGDEAISEYKSVIYYQVKQPR    421 - 490
WFETVKVAIPIEDVNRSHLRFTFRHRSSQDSKDKSEKIFALAFVKLMRYDGTTLRDGEHDLIVYKAEAKK    491 - 560
LEDAATYLSLPSTKAELEEKGHSATGKSMQSLGSCTISKDSFQISTLVCSTKLTQNVDLLGLLKWRSNTS    561 - 630
LLQQNLRQLMKVDGGEVVKFLQDTLDALFNIMMENSESETFDTLVFDALVFIIGLIADRKFQHFNPVLET    631 - 700
YIKKHFSATLAYTKLTKVLKNYVDGAEKPGVNEQLYKAMKALESIFKFIVRSRILFNQLYENKGEADFVE    701 - 770
SLLQLFRSINDMMSSMSDQTVRVKGAALKYLPTIVNDVKLVFDPKELSKMFTEFILNVPMGLLTIQKLYC    771 - 840
LIEIVHSDLFTQHDCREILLPMMTDQLKYHLERQEDLEACCQLLSHILEVLYRKDVGPTQRHVQIIMEKL    841 - 910
LRTVNRTVISMGRDSELIGNFVACMTAILRQMEDYHYAHLIKTFGKMRTDVVDFLMETFIMFKNLIGKNV    911 - 980
YPFDWVIMNMVQNKVFLRAINQYADMLNKKFLDQANFELQLWNNYFHLAVAFLTQESLQLENFSSAKRAK    981 - 1050
ILNKYGDMRRQIGFEIRDMWYNLGQHKIKFIPEMVGPILEMTLIPETELRKATIPIFFDMMQCEFHSTRS   1051 - 1120
FQMFENEIITKLDHEVEGGRGDEQYKVLFDKILLEHCRKHKYLAKTGETFVKLVVRLMERLLDYRTIMHD   1121 - 1190
ENKENRMSCTVNVLNFYKEIEREEMYIRYLYKLCDLHKECDNYTEAAYTLLLHAKLLKWSEDVCVAHLTQ   1191 - 1260
RDGYQATTQGQLKEQLYQEIIHYFDKGKMWEEAIALGKELAEQYENEMFDYEQLSELLKKQAQFYENIVK   1261 - 1330
VIRPKPDYFAVGYYGQGFPTFLRGKVFIYRGKEYERREDFEARLLTQFPNAEKMKTTSPPGDDIKNSPGQ   1331 - 1400
YIQCFTVKPKLDLPPKFHRPVSEQIVSFYRVNEVQRFEYSRPIRKGEKNPDNEFANMWIERTIYTTAYKL   1401 - 1470
PGILRWFEVKSVFMVEISPLENAIETMQLTNDKINSMVQQHLDDPSLPINPLSMLLNGIVDPAVMGGFAN   1471 - 1540
YEKAFFTDRYLQEHPEAHEKIEKLKDLIAWQIPFLAEGIRIHGDKVTEALRPFHERMEACFKQLKEKVEK   1541 - 1610
EYGVRIMPSSLDDRRGSRPRSMVRSFTMPSSSRPLSVASVSSLSSDSTPSRPGSDGFALEPLLPKKMHSR   1611 - 1680
SQDKLDKDDLEKEKKDKKKEKRNSKHQEIFEKEFKPTDISLQQSEAVILSETISPLRPQRPKSQVMNVIG   1681 - 1750
SERRFSVSPSSPSSQQTPPPVTPRAKLSFSMQSSLELNGMTGADVADVPPPLPLKGSVADYGNLMENQDL   1751 - 1820
LGSPTPPPPPPHQRHLPPPLPSKTPPPPPPKTTRKQASVDSGIVQ                            1821 - 1865
//

Text Mined References (65)

PMID Year Title
25586182 2015 The bipartite rac1 Guanine nucleotide exchange factor engulfment and cell motility 1/dedicator of cytokinesis 180 (elmo1/dock180) protects endothelial cells from apoptosis in blood vessel development.
24819662 2014 Elmo1 helps dock180 to regulate Rac1 activity and cell migration of ovarian cancer.
24564958 2014 Variability in the common genetic architecture of social-communication spectrum phenotypes during childhood and adolescence.
24483146 2014 Discovery of genetic biomarkers contributing to variation in drug response of cytidine analogues using human lymphoblastoid cell lines.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24167658 2013 CRK SH3N Domain Diminishes Cell Invasiveness of Non-Small Cell Lung Cancer.
23728337 2014 EGFRvIII stimulates glioma growth and invasion through PKA-dependent serine phosphorylation of Dock180.
23592719 2013 Rac-specific guanine nucleotide exchange factor DOCK1 is a critical regulator of HER2-mediated breast cancer metastasis.
23591873 2013 Association between G?i2 and ELMO1/Dock180 connects chemokine signalling with Rac activation and metastasis.
23314417 2013 Pro-survival effect of Dock180 overexpression on rat-derived H9C2 cardiomyocytes.
More...