Property Summary

NCBI Gene PubMed Count 14
Grant Count 12
R01 Count 7
Funding $542,804.76
PubMed Score 15.22
PubTator Score 12.03

Knowledge Summary

Patent

No data available

Gene RIF (3)

PMID Text
24570007 promoter hypermethylation and silencing of the DOC2B gene is an early and frequent event during cervical carcinogenesis and whose reduced expression due to DNA promoter methylation may lead to selective cervical tumor growth
22036572 Study analyzed Doc2alpha and Doc2beta and found that Doc2 responds to changes in [Ca2+], with markedly slower kinetics as compared to the cytosolic domain of syt I (syt), and operates on a timescale consistent with asynchronous neurotransmitter release.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MTLRRRGEKATISIQEHMAIDVCPGPIRPIKQISDYFPRFPRGLPPDAGPRAAAPPDAPARPAVAGAGRR      1 - 70
SPSDGAREDDEDVDQLFGAYGSSPGPSPGPSPARPPAKPPEDEPDADGYESDDCTALGTLDFSLLYDQEN     71 - 140
NALHCTITKAKGLKPMDHNGLADPYVKLHLLPGASKANKLRTKTLRNTLNPTWNETLTYYGITDEDMIRK    141 - 210
TLRISVCDEDKFRHNEFIGETRVPLKKLKPNHTKTFNICLEKQLPVDKTEDKSLEERGRILISLKYSSQK    211 - 280
QGLLVGIVRCAHLAAMDANGYSDPYVKTYLRPDVDKKSKHKTAVKKKTLNPEFNEEFCYEIKHGDLAKKS    281 - 350
LEVTVWDYDIGKSNDFIGGVVLGIHAKGERLKHWFDCLKNKDKRIERWHTLTSELPGAVLSD            351 - 412
//

Text Mined References (16)

PMID Year Title
24570007 2014 DNA promoter methylation-dependent transcription of the double C2-like domain ? (DOC2B) gene regulates tumor growth in human cervical cancer.
22036572 2011 Doc2 is a Ca2+ sensor required for asynchronous neurotransmitter release.
21502085 2011 Genome-wide association study implicates PARD3B-based AIDS restriction.
21220648 2011 Resequencing of 29 candidate genes in patients with familial and sporadic amyotrophic lateral sclerosis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17548353 2007 Doc2beta is a novel Munc18c-interacting partner and positive effector of syntaxin 4-mediated exocytosis.
12621583 2003 Refinement of a 400-kb critical region allows genotypic differentiation between isolated lissencephaly, Miller-Dieker syndrome, and other phenotypes secondary to deletions of 17p13.3.
10488064 1999 Transient, phorbol ester-induced DOC2-Munc13 interactions in vivo.
9804756 1998 Interaction of Doc2 with tctex-1, a light chain of cytoplasmic dynein. Implication in dynein-dependent vesicle transport.
More...