Property Summary

NCBI Gene PubMed Count 16
Grant Count 17
R01 Count 9
Funding $1,877,060.27
PubMed Score 3.75
PubTator Score 20.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytoma -1.500 0.000
posterior fossa group A ependymoma -1.500 0.000
glioblastoma -2.000 0.000
oligodendroglioma -1.500 0.000
atypical teratoid / rhabdoid tumor -1.900 0.000
medulloblastoma -1.400 0.000
primitive neuroectodermal tumor -1.200 0.000
primary pancreatic ductal adenocarcinoma -1.036 0.007
pediatric high grade glioma -1.500 0.000
pilocytic astrocytoma -1.700 0.000
Pick disease -1.200 0.003

Gene RIF (5)

PMID Text
22036572 Study analyzed Doc2alpha and Doc2beta and found that Doc2 responds to changes in [Ca2+], with markedly slower kinetics as compared to the cytosolic domain of syt I (syt), and operates on a timescale consistent with asynchronous neurotransmitter release.
20677014 Observational study of gene-disease association. (HuGE Navigator)
20489179 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19736351 Observational study of gene-disease association. (HuGE Navigator)
19242545 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MRGRRGDRMTINIQEHMAINVCPGPIRPIRQISDYFPRGPGPEGGGGGGGEAPAHLVPLALAPPAALLGA      1 - 70
TTPEDGAEVDSYDSDDATALGTLEFDLLYDRASCTLHCSILRAKGLKPMDFNGLADPYVKLHLLPGACKA     71 - 140
NKLKTKTQRNTLNPVWNEDLTYSGITDDDITHKVLRIAVCDEDKLSHNEFIGEIRVPLRRLKPSQKKHFN    141 - 210
ICLERQVPLASPSSMSAALRGISCYLKELEQAEQGQGLLEERGRILLSLSYSSRRRGLLVGILRCAHLAA    211 - 280
MDVNGYSDPYVKTYLRPDVDKKSKHKTCVKKKTLNPEFNEEFFYEIELSTLATKTLEVTVWDYDIGKSND    281 - 350
FIGGVSLGPGARGEARKHWSDCLQQPDAALERWHTLTSELPPAAGALSSA                        351 - 400
//

Text Mined References (17)

PMID Year Title
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
22036572 2011 Doc2 is a Ca2+ sensor required for asynchronous neurotransmitter release.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20489179 2010 Strong synaptic transmission impact by copy number variations in schizophrenia.
19736351 2009 Recurrent rearrangements in synaptic and neurodevelopmental genes and shared biologic pathways in schizophrenia, autism, and mental retardation.
19242545 2009 Association and mutation analyses of 16p11.2 autism candidate genes.
18354201 2008 Doc2 alpha and Munc13-4 regulate Ca(2+) -dependent secretory lysosome exocytosis in mast cells.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...