Property Summary

NCBI Gene PubMed Count 22
PubMed Score 3.76
PubTator Score 2.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
non-small cell lung cancer 2890 1.8e-17
osteosarcoma 7950 2.0e-06
malignant mesothelioma 3232 3.2e-06
medulloblastoma, large-cell 6241 1.2e-04
Disease Target Count Z-score Confidence
Ovarian serous carcinoma 5 3.325 1.7

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 1.400 3.2e-06
medulloblastoma, large-cell 1.200 1.2e-04
non-small cell lung cancer 1.083 1.8e-17
osteosarcoma -1.329 2.0e-06

Protein-protein Interaction (1)

Gene RIF (6)

AA Sequence

MSASAQQLAEELQIFGLDCEEALIEKLVELCVQYGQNEEGMVGELIAFCTSTHKVGLTSEILNSFEHEFL      1 - 70
SKRLSKARHSTCKDSGHAGARDIVSIQELIEVEEEEEILLNSYTTPSKGSQKRAISTPETPLTKRSVSTR     71 - 140
SPHQLLSPSSFSPSATPSQKYNSRSNRGEVVTSFGLAQGVSWSGRGGAGNISLKVLGCPEALTGSYKSMF    141 - 210
QKLPDIREVLTCKIEELGSELKEHYKIEAFTPLLAPAQEPVTLLGQIGCDSNGKLNNKSVILEGDREHSS    211 - 280
GAQIPVDLSELKEYSLFPGQVVIMEGINTTGRKLVATKLYEGVPLPFYQPTEEDADFEQSMVLVACGPYT    281 - 350
TSDSITYDPLLDLIAVINHDRPDVCILFGPFLDAKHEQVENCLLTSPFEDIFKQCLRTIIEGTRSSGSHL    351 - 420
VFVPSLRDVHHEPVYPQPPFSYSDLSREDKKQVQFVSEPCSLSINGVIFGLTSTDLLFHLGAEEISSSSG    421 - 490
TSDRFSRILKHILTQRSYYPLYPPQEDMAIDYESFYVYAQLPVTPDVLIIPSELRYFVKDVLGCVCVNPG    491 - 560
RLTKGQVGGTFARLYLRRPAADGAERQSPCIAVQVVRI                                    561 - 598
//

Text Mined References (30)

PMID Year Title