Property Summary

NCBI Gene PubMed Count 20
PubMed Score 3.09
PubTator Score 2.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 1.400 0.000
osteosarcoma -1.329 0.000
medulloblastoma, large-cell 1.200 0.000
non-small cell lung cancer 1.083 0.000

Synonym

Accession Q14181 B4DNB4 Q9BPV3
Symbols

Gene

PDB

5EXR   4Y97   2KEB   4E2I  

Gene RIF (4)

PMID Text
25521664 POLA2+1747 GG/GA may be used as a prognostic biomarker of patient outcome in NSCLC pathogenesis
22593576 Findings indicate that tethering of primase to the replisome by DNA polymerase alpha (pol alpha) is critical for the normal action of DNA replication forks in eukaryotic cells.
20800603 Observational study of gene-disease association. (HuGE Navigator)
19237606 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)

AA Sequence

MSASAQQLAEELQIFGLDCEEALIEKLVELCVQYGQNEEGMVGELIAFCTSTHKVGLTSEILNSFEHEFL      1 - 70
SKRLSKARHSTCKDSGHAGARDIVSIQELIEVEEEEEILLNSYTTPSKGSQKRAISTPETPLTKRSVSTR     71 - 140
SPHQLLSPSSFSPSATPSQKYNSRSNRGEVVTSFGLAQGVSWSGRGGAGNISLKVLGCPEALTGSYKSMF    141 - 210
QKLPDIREVLTCKIEELGSELKEHYKIEAFTPLLAPAQEPVTLLGQIGCDSNGKLNNKSVILEGDREHSS    211 - 280
GAQIPVDLSELKEYSLFPGQVVIMEGINTTGRKLVATKLYEGVPLPFYQPTEEDADFEQSMVLVACGPYT    281 - 350
TSDSITYDPLLDLIAVINHDRPDVCILFGPFLDAKHEQVENCLLTSPFEDIFKQCLRTIIEGTRSSGSHL    351 - 420
VFVPSLRDVHHEPVYPQPPFSYSDLSREDKKQVQFVSEPCSLSINGVIFGLTSTDLLFHLGAEEISSSSG    421 - 490
TSDRFSRILKHILTQRSYYPLYPPQEDMAIDYESFYVYAQLPVTPDVLIIPSELRYFVKDVLGCVCVNPG    491 - 560
RLTKGQVGGTFARLYLRRPAADGAERQSPCIAVQVVRI                                    561 - 598
//

Text Mined References (28)

PMID Year Title
25521664 2014 Novel SNP improves differential survivability and mortality in non-small cell lung cancer patients.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22593576 2012 A conserved motif in the C-terminal tail of DNA polymerase ? tethers primase to the eukaryotic replisome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19237606 2009 Genetic polymorphisms in 85 DNA repair genes and bladder cancer risk.
More...