Property Summary

NCBI Gene PubMed Count 12
PubMed Score 48.93
PubTator Score 11.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
astrocytoma 1.800 2.5e-03
autosomal dominant Emery-Dreifuss muscul... -1.135 3.8e-02
Becker muscular dystrophy -1.280 2.0e-02
Breast cancer 3.400 2.3e-02
Duchenne muscular dystrophy -1.027 2.8e-03
esophageal adenocarcinoma 1.300 2.1e-02
glioblastoma 1.600 3.0e-04
group 4 medulloblastoma -1.400 3.0e-02
limb girdle muscular dystrophy 2I -1.246 6.2e-03
lung adenocarcinoma 1.238 1.6e-04
lung cancer 1.800 2.1e-05
medulloblastoma, large-cell -1.900 5.3e-04
non primary Sjogren syndrome sicca 1.200 2.4e-02
ovarian cancer 2.700 1.2e-06
pancreatic ductal adenocarcinoma liver m... -1.108 3.0e-02
pediatric high grade glioma 1.100 6.8e-06
Pick disease 1.200 6.7e-06
pituitary cancer -1.400 1.5e-05
Rheumatoid arthritis -1.200 2.9e-03
spina bifida 1.074 3.6e-02
subependymal giant cell astrocytoma 1.875 1.8e-02

Gene RIF (5)

AA Sequence

MLGAWAVEGTAVALLRLLLLLLPPAIRGPGLGVAGVAGAAGAGLPESVIWAVNAGGEAHVDVHGIHFRKD      1 - 70
PLEGRVGRASDYGMKLPILRSNPEDQILYQTERYNEETFGYEVPIKEEGDYVLVLKFAEVYFAQSQQKVF     71 - 140
DVRLNGHVVVKDLDIFDRVGHSTAHDEIIPMSIRKGKLSVQGEVSTFTGKLYIEFVKGYYDNPKVCALYI    141 - 210
MAGTVDDVPKLQPHPGLEKKEEEEEEEEYDEGSNLKKQTNKNRVQSGPRTPNPYASDNSSLMFPILVAFG    211 - 280
VFIPTLFCLCRL                                                              281 - 292
//

Text Mined References (15)

PMID Year Title