Property Summary

NCBI Gene PubMed Count 11
Grant Count 5
Funding $1,626,740.2
PubMed Score 43.10
PubTator Score 11.35

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q14165
Symbols KIAA0152

Gene

Gene RIF (4)

PMID Text
22988243 Data indicate that malectin functions by forming a complex with ribophorin I.
21813736 These observations suggest a possible role of malectin in regulating newly synthesized glycoproteins via G2M9 recognition.
20347265 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18524852 Malectin is a novel carbohydrate-binding protein of the endoplasmic reticulum and a candidate player in the early steps of protein N-glycosylation

AA Sequence

MLGAWAVEGTAVALLRLLLLLLPPAIRGPGLGVAGVAGAAGAGLPESVIWAVNAGGEAHVDVHGIHFRKD      1 - 70
PLEGRVGRASDYGMKLPILRSNPEDQILYQTERYNEETFGYEVPIKEEGDYVLVLKFAEVYFAQSQQKVF     71 - 140
DVRLNGHVVVKDLDIFDRVGHSTAHDEIIPMSIRKGKLSVQGEVSTFTGKLYIEFVKGYYDNPKVCALYI    141 - 210
MAGTVDDVPKLQPHPGLEKKEEEEEEEEYDEGSNLKKQTNKNRVQSGPRTPNPYASDNSSLMFPILVAFG    211 - 280
VFIPTLFCLCRL                                                              281 - 292
//

Text Mined References (14)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22988243 2012 Malectin forms a complex with ribophorin I for enhanced association with misfolded glycoproteins.
21813736 2011 Role of malectin in Glc(2)Man(9)GlcNAc(2)-dependent quality control of ?1-antitrypsin.
21269460 2011 Initial characterization of the human central proteome.
20347265 2010 MicroRNAs and target site screening reveals a pre-microRNA-30e variant associated with schizophrenia.
19946888 2010 Defining the membrane proteome of NK cells.
18524852 2008 Malectin: a novel carbohydrate-binding protein of the endoplasmic reticulum and a candidate player in the early steps of protein N-glycosylation.
18303019 2008 Getting in and out from calnexin/calreticulin cycles.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
More...