Property Summary

NCBI Gene PubMed Count 11
PubMed Score 43.10
PubTator Score 11.35

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 1.1854549230252E-6
Pick disease 1893 6.68338401204126E-6
pediatric high grade glioma 2712 6.78231821465838E-6
pituitary cancer 1972 1.47370088769451E-5
lung cancer 4473 6.54024971579632E-5
lung adenocarcinoma 2714 1.57348500240646E-4
glioblastoma 5572 2.99173173667421E-4
medulloblastoma, large-cell 6234 5.32690560211588E-4
astrocytoma 1493 0.0024755425539393
Duchenne muscular dystrophy 602 0.00276488878834553
Rheumatoid Arthritis 1171 0.00294247066937735
limb girdle muscular dystrophy 2I 56 0.00621210192370904
subependymal giant cell astrocytoma 2287 0.0181142879178292
Becker muscular dystrophy 187 0.0196431866846571
esophageal adenocarcinoma 737 0.0214020317316477
Breast cancer 3099 0.0226493960636325
non primary Sjogren syndrome sicca 840 0.0238076669324182
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0297788939100184
group 4 medulloblastoma 1875 0.0298453730232158
spina bifida 1064 0.035726328509748
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.0382113256726375
Disease Target Count Z-score Confidence
Leprosy 77 3.379 1.7

Expression

Synonym

Accession Q14165
Symbols KIAA0152

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA Inparanoid
Rat EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid

 MGI Term (1)

Gene RIF (4)

PMID Text
22988243 Data indicate that malectin functions by forming a complex with ribophorin I.
21813736 These observations suggest a possible role of malectin in regulating newly synthesized glycoproteins via G2M9 recognition.
20347265 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18524852 Malectin is a novel carbohydrate-binding protein of the endoplasmic reticulum and a candidate player in the early steps of protein N-glycosylation

AA Sequence

MLGAWAVEGTAVALLRLLLLLLPPAIRGPGLGVAGVAGAAGAGLPESVIWAVNAGGEAHVDVHGIHFRKD      1 - 70
PLEGRVGRASDYGMKLPILRSNPEDQILYQTERYNEETFGYEVPIKEEGDYVLVLKFAEVYFAQSQQKVF     71 - 140
DVRLNGHVVVKDLDIFDRVGHSTAHDEIIPMSIRKGKLSVQGEVSTFTGKLYIEFVKGYYDNPKVCALYI    141 - 210
MAGTVDDVPKLQPHPGLEKKEEEEEEEEYDEGSNLKKQTNKNRVQSGPRTPNPYASDNSSLMFPILVAFG    211 - 280
VFIPTLFCLCRL                                                              281 - 292
//

Text Mined References (14)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22988243 2012 Malectin forms a complex with ribophorin I for enhanced association with misfolded glycoproteins.
21813736 2011 Role of malectin in Glc(2)Man(9)GlcNAc(2)-dependent quality control of ?1-antitrypsin.
21269460 2011 Initial characterization of the human central proteome.
20347265 2010 MicroRNAs and target site screening reveals a pre-microRNA-30e variant associated with schizophrenia.
19946888 2010 Defining the membrane proteome of NK cells.
18524852 2008 Malectin: a novel carbohydrate-binding protein of the endoplasmic reticulum and a candidate player in the early steps of protein N-glycosylation.
18303019 2008 Getting in and out from calnexin/calreticulin cycles.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
More...