Property Summary

NCBI Gene PubMed Count 112
Grant Count 71
R01 Count 36
Funding $7,199,169.72
PubMed Score 39.50
PubTator Score 70.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Panic disorder 55 3.037 1.5
psoriasis 6,685

Synonym

Accession Q14164 D3DT78 Q3B754 Q3KR43 Q5JTS6 I-kappa-B kinase epsilon
Symbols IKKE
IKKI
IKK-E
IKK-i

Gene

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (75)

PMID Text
26647356 The P proteins from the rabies virus street strains 1088 and HCM-9 significantly inhibited I-kappa B kinase (IKK)-inducible IRF-3-dependent IFN-beta promoter activity.
26354181 These findings collectively support the conclusion that IKK modulates innate immune signaling cascades via phosphorylating the RIG-I cytosolic sensor, providing a feedback regulatory mechanism.
26177467 Blunting of NOX2-dependent IKKepsilon oncogenic kinase expression reduces proliferation and viability of human breast cancer cells.
26025939 IKBKE Upregulation is Positively Associated with Squamous Cell Carcinoma of the Lung In Vivo and Malignant Transformation of Human Bronchial Epithelial Cells In Vitro.
25780039 A role for APPL1 in TLR3/4-dependent TBK1 and IKKepsilon activation in macrophages.
25656572 The above-mentioned data suggest that let-7b/i inhibit the invasive ability of glioma cells by directly downregulating IKBKE and indirectly upregulating E-cadherin.
25540417 IKBKE is a novel regulator that limits chronic inflammation during metabolic disease and atherosclerosis. The pathogenic relevance of IKBKE was indicated by the colocalization with macrophages in tissues and in atherosclerotic plaques.
25531185 HTLV-1 Tax is recruited into the TBK1/IKKvarepsilon complexes as a scaffolding-adaptor protein that enhances IFN-beta gene expression.
25365225 these findings reveal that IKBKE-associated cytokine signaling promotes tumorigenicity of immune-driven TNBC and identify a potential therapeutic strategy using clinically available compounds.
24867235 DC-SIGN directs adaptive T helper cell type-2immunity to fucose-expressing pathogens via an IKKepsilon-CYLD-dependent signalling pathway leading to Bcl3 activation.
More...

AA Sequence

MQSTANYLWHTDDLLGQGATASVYKARNKKSGELVAVKVFNTTSYLRPREVQVREFEVLRKLNHQNIVKL      1 - 70
FAVEETGGSRQKVLVMEYCSSGSLLSVLESPENAFGLPEDEFLVVLRCVVAGMNHLRENGIVHRDIKPGN     71 - 140
IMRLVGEEGQSIYKLTDFGAARELDDDEKFVSVYGTEEYLHPDMYERAVLRKPQQKAFGVTVDLWSIGVT    141 - 210
LYHAATGSLPFIPFGGPRRNKEIMYRITTEKPAGAIAGAQRRENGPLEWSYTLPITCQLSLGLQSQLVPI    211 - 280
LANILEVEQAKCWGFDQFFAETSDILQRVVVHVFSLSQAVLHHIYIHAHNTIAIFQEAVHKQTSVAPRHQ    281 - 350
EYLFEGHLCVLEPSVSAQHIAHTTASSPLTLFSTAIPKGLAFRDPALDVPKFVPKVDLQADYNTAKGVLG    351 - 420
AGYQALRLARALLDGQELMFRGLHWVMEVLQATCRRTLEVARTSLLYLSSSLGTERFSSVAGTPEIQELK    421 - 490
AAAELRSRLRTLAEVLSRCSQNITETQESLSSLNRELVKSRDQVHEDRSIQQIQCCLDKMNFIYKQFKKS    491 - 560
RMRPGLGYNEEQIHKLDKVNFSHLAKRLLQVFQEECVQKYQASLVTHGKRMRVVHETRNHLRLVGCSVAA    561 - 630
CNTEAQGVQESLSKLLEELSHQLLQDRAKGAQASPPPIAPYPSPTRKDLLLHMQELCEGMKLLASDLLDN    631 - 700
NRIIERLNRVPAPPDV                                                          701 - 716
//

Text Mined References (118)

PMID Year Title
26647356 2016 Contribution of the interaction between the rabies virus P protein and I-kappa B kinase ? to the inhibition of type I IFN induction signalling.
26354181 2016 IKK? negatively regulates RIG-I via direct phosphorylation.
26177467 2015 Redox-modulating agents target NOX2-dependent IKK? oncogenic kinase expression and proliferation in human breast cancer cell lines.
26025939 2015 IKBKE Upregulation is Positively Associated with Squamous Cell Carcinoma of the Lung In Vivo and Malignant Transformation of Human Bronchial Epithelial Cells In Vitro.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25780039 2015 A role for APPL1 in TLR3/4-dependent TBK1 and IKK? activation in macrophages.
25656572 2015 MicroRNAs let-7b/i suppress human glioma cell invasion and migration by targeting IKBKE directly.
25540417 2015 Hematopoietic IKBKE limits the chronicity of inflammasome priming and metaflammation.
25531185 2015 HTLV-1 Tax protein recruitment into IKK? and TBK1 kinase complexes enhances IFN-I expression.
25365225 2014 Targeting an IKBKE cytokine network impairs triple-negative breast cancer growth.
More...