Property Summary

NCBI Gene PubMed Count 68
Grant Count 43
R01 Count 25
Funding $5,648,304.11
PubMed Score 54.53
PubTator Score 69.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytoma 1.700 0.008
posterior fossa group B ependymoma 1.400 0.000
psoriasis 1.100 0.002
tuberculosis 1.100 0.000
pancreatic ductal adenocarcinoma liver m... 1.048 0.010
lung cancer 1.300 0.001
lung adenocarcinoma 1.200 0.000
ovarian cancer 2.400 0.000

Gene RIF (53)

PMID Text
26527679 loss of Scribble-induced HuR translocation mediates the accumulation of Snail via activation of the p38 MAPK pathway.
25734361 The two PDZ domains within the PDZ34 tandem of Scribble, a cell polarity regulator, tightly pack in a 'front-to-back' mode to form a compact supramodule.
24662921 High levels of mislocalized SCRIB functions as a neomorph to promote mammary tumorigenesis.
24527800 miR-296-5p/SCRIB axis plays a role in breast carcinogenesis
24276238 We show that loss of Scrib and activated oncogenic KRas cooperate in vivo, resulting in more aggressive lung tumors
24211266 SHOC2 and MRAS form a complex with SCRIB.
24140112 Haploinsufficiency of each of SCRIB or PUF60 contribute uniquely to specific endophenotypes (e.g., coloboma, heart defects), and binary interaction potentially exacerbates other aspects of the clinical pathology of individuals with 8q24.3 deletion.
23922697 This study demonstrated that rare deleterious mutations of SCRIB may contribute to the multifactorial risk for human spina bifida.
23813956 These data suggests a novel role for Scribble in positively regulating tight junction assembly through transcriptional regulation of an epithelial-to-mesenchymal signaling program.
23774808 Although the Scribble P305L mislocalization mutant can no longer suppress Ras-MAPK-induced invasion or epithelial to mesenchymal transition phenotypes, mislocalized Scribble can still suppress anchorage-independent cell growth.
More...

AA Sequence

MLKCIPLWRCNRHVESVDKRHCSLQAVPEEIYRYSRSLEELLLDANQLRELPKPFFRLLNLRKLGLSDNE      1 - 70
IQRLPPEVANFMQLVELDVSRNDIPEIPESIKFCKALEIADFSGNPLSRLPDGFTQLRSLAHLALNDVSL     71 - 140
QALPGDVGNLANLVTLELRENLLKSLPASLSFLVKLEQLDLGGNDLEVLPDTLGALPNLRELWLDRNQLS    141 - 210
ALPPELGNLRRLVCLDVSENRLEELPAELGGLVLLTDLLLSQNLLRRLPDGIGQLKQLSILKVDQNRLCE    211 - 280
VTEAIGDCENLSELILTENLLMALPRSLGKLTKLTNLNVDRNHLEALPPEIGGCVALSVLSLRDNRLAVL    281 - 350
PPELAHTTELHVLDVAGNRLQSLPFALTHLNLKALWLAENQAQPMLRFQTEDDARTGEKVLTCYLLPQQP    351 - 420
PPSLEDAGQQGSLSETWSDAPPSRVSVIQFLEAPIGDEDAEEAAAEKRGLQRRATPHPSELKVMKRSIEG    421 - 490
RRSEACPCQPDSGSPLPAEEEKRLSAESGLSEDSRPSASTVSEAEPEGPSAEAQGGSQQEATTAGGEEDA    491 - 560
EEDYQEPTVHFAEDALLPGDDREIEEGQPEAPWTLPGGRQRLIRKDTPHYKKHFKISKLPQPEAVVALLQ    561 - 630
GMQPDGEGPVAPGGWHNGPHAPWAPRAQKEEEEEEEGSPQEEEVEEEEENRAEEEEASTEEEDKEGAVVS    631 - 700
APSVKGVSFDQANNLLIEPARIEEEELTLTILRQTGGLGISIAGGKGSTPYKGDDEGIFISRVSEEGPAA    701 - 770
RAGVRVGDKLLEVNGVALQGAEHHEAVEALRGAGTAVQMRVWRERMVEPENAVTITPLRPEDDYSPRERR    771 - 840
GGGLRLPLLPPESPGPLRQRHVACLARSERGLGFSIAGGKGSTPYRAGDAGIFVSRIAEGGAAHRAGTLQ    841 - 910
VGDRVLSINGVDVTEARHDHAVSLLTAASPTIALLLEREAGGPLPPSPLPHSSPPTAAVATTSITTATPG    911 - 980
VPGLPSLAPSLLAAALEGPYPVEEIRLPRAGGPLGLSIVGGSDHSSHPFGVQEPGVFISKVLPRGLAARS    981 - 1050
GLRVGDRILAVNGQDVRDATHQEAVSALLRPCLELSLLVRRDPAPPGLRELCIQKAPGERLGISIRGGAR   1051 - 1120
GHAGNPRDPTDEGIFISKVSPTGAAGRDGRLRVGLRLLEVNQQSLLGLTHGEAVQLLRSVGDTLTVLVCD   1121 - 1190
GFEASTDAALEVSPGVIANPFAAGIGHRNSLESISSIDRELSPEGPGKEKELPGQTLHWGPEATEAAGRG   1191 - 1260
LQPLKLDYRALAAVPSAGSVQRVPSGAAGGKMAESPCSPSGQQPPSPPSPDELPANVKQAYRAFAAVPTS   1261 - 1330
HPPEDAPAQPPTPGPAASPEQLSFRERQKYFELEVRVPQAEGPPKRVSLVGADDLRKMQEEEARKLQQKR   1331 - 1400
AQMLREAAEAGAEARLALDGETLGEEEQEDEQPPWASPSPTSRQSPASPPPLGGGAPVRTAKAERRHQER   1401 - 1470
LRVQSPEPPAPERALSPAELRALEAEKRALWRAARMKSLEQDALRAQMVLSRSQEGRGTRGPLERLAEAP   1471 - 1540
SPAPTPSPTPVEDLGPQTSTSPGRLSPDFAEELRSLEPSPSPGPQEEDGEVALVLLGRPSPGAVGPEDVA   1541 - 1610
LCSSRRPVRPGRRGLGPVPS                                                     1611 - 1630
//

Text Mined References (80)

PMID Year Title
26527679 2016 Loss of Scribble Promotes Snail Translation through Translocation of HuR and Enhances Cancer Drug Resistance.
25734361 2015 Interdomain interface-mediated target recognition by the Scribble PDZ34 supramodule.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
24662921 2014 Mislocalization of the cell polarity protein scribble promotes mammary tumorigenesis and is associated with basal breast cancer.
24527800 2014 miR-296/Scribble axis is deregulated in human breast cancer and miR-296 restoration reduces tumour growth in vivo.
24276238 2014 Scrib heterozygosity predisposes to lung cancer and cooperates with KRas hyperactivation to accelerate lung cancer progression in vivo.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24211266 2013 An MRAS, SHOC2, and SCRIB complex coordinates ERK pathway activation with polarity and tumorigenic growth.
24140112 2013 SCRIB and PUF60 are primary drivers of the multisystemic phenotypes of the 8q24.3 copy-number variant.
More...