Property Summary

NCBI Gene PubMed Count 24
PubMed Score 11.38
PubTator Score 8.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
astrocytoma 1.400 7.1e-03
atypical teratoid / rhabdoid tumor 1.900 2.6e-09
Breast cancer 1.100 1.1e-11
colon cancer 1.200 2.9e-03
glioblastoma 2.000 2.3e-09
group 4 medulloblastoma 1.500 3.5e-04
intraductal papillary-mucinous adenoma (... 1.600 1.8e-03
intraductal papillary-mucinous carcinoma... 1.500 3.4e-03
intraductal papillary-mucinous neoplasm ... 1.200 2.5e-02
invasive ductal carcinoma 1.200 5.6e-04
lung cancer 1.300 2.9e-03
medulloblastoma, large-cell 2.000 1.1e-07
oligodendroglioma 1.100 4.5e-03
osteosarcoma -1.347 1.3e-03
ovarian cancer 1.900 4.4e-07
pediatric high grade glioma 1.400 3.6e-06
primitive neuroectodermal tumor 1.400 1.5e-05
psoriasis -2.200 4.3e-04

Gene RIF (10)

AA Sequence

MMTSVGTNRARGNWEQPQNQNQTQHKQRPQATAEQIRLAQMISDHNDADFEEKVKQLIDITGKNQDECVI      1 - 70
ALHDCNGDVNRAINVLLEGNPDTHSWEMVGKKKGVSGQKDGGQTESNEEGKENRDRDRDYSRRRGGPPRR     71 - 140
GRGASRGREFRGQENGLDGTKSGGPSGRGTERGRRGRGRGRGGSGRRGGRFSAQGMGTFNPADYAEPANT    141 - 210
DDNYGNSSGNTWNNTGHFEPDDGTSAWRTATEEWGTEDWNEDLSETKIFTASNVSSVPLPAENVTITAGQ    211 - 280
RIDLAVLLGKTPSTMENDSSNLDPSQAPSLAQPLVFSNSKQTAISQPASGNTFSHHSMVSMLGKGFGDVG    281 - 350
EAKGGSTTGSQFLEQFKTAQALAQLAAQHSQSGSTTTSSWDMGSTTQSPSLVQYDLKNPSDSAVHSPFTK    351 - 420
RQAFTPSSTMMEVFLQEKSPAVATSTAAPPPPSSPLPSKSTSAPQMSPGSSDNQSSSPQPAQQKLKQQKK    421 - 490
KASLTSKIPALAVEMPGSADISGLNLQFGALQFGSEPVLSDYESTPTTSASSSQAPSSLYTSTASESSST    491 - 560
ISSNQSQESGYQSGPIQSTTYTSQNNAQGPLYEQRSTQTRRYPSSISSSPQKDLTQAKNGFSSVQATQLQ    561 - 630
TTQSVEGATGSAVKSDSPSTSSIPPLNETVSAASLLTTTNQHSSSLGGLSHSEEIPNTTTTQHSSTLSTQ    631 - 700
QNTLSSSTSSGRTSTSTLLHTSVESEANLHSSSSTFSTTSSTVSAPPPVVSVSSSLNSGSSLGLSLGSNS    701 - 770
TVTASTRSSVATTSGKAPPNLPPGVPPLLPNPYIMAPGLLHAYPPQVYGYDDLQMLQTRFPLDYYSIPFP    771 - 840
TPTTPLTGRDGSLASNPYSGDLTKFGRGDASSPAPATTLAQPQQNQTQTHHTTQQTFLNPALPPGYSYTS    841 - 910
LPYYTGVPGLPSTFQYGPAVFPVAPTSSKQHGVNVSVNASATPFQQPSGYGSHGYNTGVSVTSSNTGVPD    911 - 980
ISGSVYSKTQQSFEKQGFHSGTPAASFNLPSALGSGGPINPATAAAYPPAPFMHILTPHQQPHSQILHHH    981 - 1050
LQQDGQTGSGQRSQTSSIPQKPQTNKSAYNSYSWGAN                                    1051 - 1087
//

Text Mined References (41)

PMID Year Title