Property Summary

NCBI Gene PubMed Count 22
PubMed Score 8.45
PubTator Score 8.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
glioblastoma 5572 2.30578593320371E-9
atypical teratoid / rhabdoid tumor 4369 2.56670293782224E-9
medulloblastoma, large-cell 6234 1.06016045602901E-7
ovarian cancer 8492 4.42150195066171E-7
pediatric high grade glioma 2712 3.61700432719559E-6
primitive neuroectodermal tumor 3031 1.52682718045484E-5
medulloblastoma 1524 6.73022830578698E-5
psoriasis 6685 4.33796421489709E-4
invasive ductal carcinoma 2950 5.58088537346883E-4
inflammatory breast cancer 404 0.00121556691119848
osteosarcoma 7933 0.00128808847678102
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0018079974655065
colon cancer 1475 0.00290884850366819
lung cancer 4473 0.00294975119611925
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00342587908181417
oligodendroglioma 2849 0.00453451631846784
astrocytoma 1493 0.00710070343880199
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0245333918261164
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

Synonym

Accession Q14157 B4E0U8 Q5VU75 Q5VU76 Q9BTU3 Q9UGL2 Q9UGL3 Q9UGL4 Q9UGL5
Symbols NICE4
NICE-4

Gene

  Ortholog (9)

Gene RIF (7)

PMID Text
26381755 arginine residues in the RGG/RG motif of UBAP2L were directly methylated by PRMT1. RGG/RG motif of UBAP2L is essential for the proper alignment of chromosomes.
26310274 These results suggest that UBAP2L has a key role in glioma cell growth, and may act as an oncogene to promote malignant glioma development.
25631074 Cellular biotinylated ubiquitin associated protein 2-like (UBAP2L) is incorporated into HIV-1 Gag virus-like particles
25185265 Two different BMI1-containing PcG complexes regulate hematopoietic stem cell activity, which are distinguishable by the presence of UBAP2L.
25069639 Knockdown of UBAP2L in prostate carcinoma inhibited cell proliferation, migration, and colony formation ability, and blocked cell cycle progression.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20200978 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MMTSVGTNRARGNWEQPQNQNQTQHKQRPQATAEQIRLAQMISDHNDADFEEKVKQLIDITGKNQDECVI      1 - 70
ALHDCNGDVNRAINVLLEGNPDTHSWEMVGKKKGVSGQKDGGQTESNEEGKENRDRDRDYSRRRGGPPRR     71 - 140
GRGASRGREFRGQENGLDGTKSGGPSGRGTERGRRGRGRGRGGSGRRGGRFSAQGMGTFNPADYAEPANT    141 - 210
DDNYGNSSGNTWNNTGHFEPDDGTSAWRTATEEWGTEDWNEDLSETKIFTASNVSSVPLPAENVTITAGQ    211 - 280
RIDLAVLLGKTPSTMENDSSNLDPSQAPSLAQPLVFSNSKQTAISQPASGNTFSHHSMVSMLGKGFGDVG    281 - 350
EAKGGSTTGSQFLEQFKTAQALAQLAAQHSQSGSTTTSSWDMGSTTQSPSLVQYDLKNPSDSAVHSPFTK    351 - 420
RQAFTPSSTMMEVFLQEKSPAVATSTAAPPPPSSPLPSKSTSAPQMSPGSSDNQSSSPQPAQQKLKQQKK    421 - 490
KASLTSKIPALAVEMPGSADISGLNLQFGALQFGSEPVLSDYESTPTTSASSSQAPSSLYTSTASESSST    491 - 560
ISSNQSQESGYQSGPIQSTTYTSQNNAQGPLYEQRSTQTRRYPSSISSSPQKDLTQAKNGFSSVQATQLQ    561 - 630
TTQSVEGATGSAVKSDSPSTSSIPPLNETVSAASLLTTTNQHSSSLGGLSHSEEIPNTTTTQHSSTLSTQ    631 - 700
QNTLSSSTSSGRTSTSTLLHTSVESEANLHSSSSTFSTTSSTVSAPPPVVSVSSSLNSGSSLGLSLGSNS    701 - 770
TVTASTRSSVATTSGKAPPNLPPGVPPLLPNPYIMAPGLLHAYPPQVYGYDDLQMLQTRFPLDYYSIPFP    771 - 840
TPTTPLTGRDGSLASNPYSGDLTKFGRGDASSPAPATTLAQPQQNQTQTHHTTQQTFLNPALPPGYSYTS    841 - 910
LPYYTGVPGLPSTFQYGPAVFPVAPTSSKQHGVNVSVNASATPFQQPSGYGSHGYNTGVSVTSSNTGVPD    911 - 980
ISGSVYSKTQQSFEKQGFHSGTPAASFNLPSALGSGGPINPATAAAYPPAPFMHILTPHQQPHSQILHHH    981 - 1050
LQQDGQTGSGQRSQTSSIPQKPQTNKSAYNSYSWGAN                                    1051 - 1087
//

Text Mined References (39)

PMID Year Title
26381755 2016 Arginine methylation of ubiquitin-associated protein 2-like is required for the accurate distribution of chromosomes.
26310274 2015 Downregulation of ubiquitin-associated protein 2-like with a short hairpin RNA inhibits human glioma cell growth in vitro.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25185265 2014 UBAP2L is a novel BMI1-interacting protein essential for hematopoietic stem cell activity.
25069639 2014 Knockdown of ubiquitin associated protein 2-like inhibits the growth and migration of prostate cancer cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
More...