Property Summary

NCBI Gene PubMed Count 10
PubMed Score 4.78
PubTator Score 0.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
IGA Glomerulonephritis 454
Disease Target Count P-value
ependymoma 2514 6.11817296006659E-13
oligodendroglioma 2849 2.69683253632358E-11
atypical teratoid / rhabdoid tumor 4369 3.04302966115181E-10
primitive neuroectodermal tumor 3031 1.98191769173825E-7
medulloblastoma 1524 6.45942022582782E-7
glioblastoma 5572 1.78493993624647E-5
pilocytic astrocytoma 3086 2.00410223123595E-5
osteosarcoma 7933 5.13287172081339E-5
dermatomyositis 967 3.10278716293121E-4
lung cancer 4473 4.31480167590559E-4
psoriasis 6685 6.20054083453481E-4
medulloblastoma, large-cell 6234 0.00105898116618777
adult high grade glioma 2148 0.00290503589409635
ovarian cancer 8492 0.02588232665362
severe Alzheimer's disease 49 0.0297086522365706
hereditary spastic paraplegia 313 0.0393579566499499
Waldenstrons macroglobulinemia 765 0.0476499996912087

Expression

  Differential Expression (17)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.262 0.048
psoriasis 1.100 0.001
oligodendroglioma -1.100 0.000
osteosarcoma 2.021 0.000
ependymoma -1.400 0.000
glioblastoma -2.000 0.000
medulloblastoma -2.400 0.000
atypical teratoid / rhabdoid tumor -2.400 0.000
medulloblastoma, large-cell -2.300 0.001
primitive neuroectodermal tumor -2.300 0.000
hereditary spastic paraplegia -1.039 0.039
lung cancer -1.600 0.000
adult high grade glioma -1.700 0.003
pilocytic astrocytoma -1.300 0.000
severe Alzheimer's disease -1.154 0.030
ovarian cancer 1.400 0.026
dermatomyositis 1.200 0.000

Synonym

Accession Q14156 A7MD19 Q2VPK2 Q63HL7 Q68DX1 Q6IQ18
Symbols

Gene

  Ortholog (11)

Pathway (1)

Gene RIF (2)

PMID Text
25380825 These data suggest that mammalian Efr3s contribute to the control of the phosphorylation state and, hence, desensitization of AT1a receptors, and could affect responsiveness of G-protein-coupled receptors in higher eukaryotes.
22082156 Knockdown of EFR3 homolog A (S. cerevisiae) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N

AA Sequence

MPTRVCCCCSALRPRYKRLVDNIFPEDPKDGLVKTDMEKLTFYAVSAPEKLDRIGSYLAERLSRDVVRHR      1 - 70
SGYVLIAMEALDQLLMACHSQSIKPFVESFLHMVAKLLESGEPKLQVLGTNSFVKFANIEEDTPSYHRRY     71 - 140
DFFVSRFSAMCHSCHSDPEIRTEIRIAGIRGIQGVVRKTVNDELRATIWEPQHMDKIVPSLLFNMQKIEE    141 - 210
VDSRIGPPSSPSATDKEENPAVLAENCFRELLGRATFGNMNNAVRPVFAHLDHHKLWDPNEFAVHCFKII    211 - 280
MYSIQAQYSHHVIQEILGHLDARKKDAPRVRAGIIQVLLEAVAIAAKGSIGPTVLEVFNTLLKHLRLSVE    281 - 350
FEANDLQGGSVGSVNLNTSSKDNDEKIVQNAIIQTIGFFGSNLPDYQRSEIMMFIMGKVPVFGTSTHTLD    351 - 420
ISQLGDLGTRRIQIMLLRSLLMVTSGYKAKTIVTALPGSFLDPLLSPSLMEDYELRQLVLEVMHNLMDRH    421 - 490
DNRAKLRGIRIIPDVADLKIKREKICRQDTSFMKKNGQQLYRHIYLGCKEEDNVQKNYELLYTSLALITI    491 - 560
ELANEEVVIDLIRLAIALQDSAIINEDNLPMFHRCGIMALVAAYLNFVSQMIAVPAFCQHVSKVIEIRTM    561 - 630
EAPYFLPEHIFRDKCMLPKSLEKHEKDLYFLTNKIAESLGGSGYSVERLSVPYVPQVTDEDRLSRRKSIV    631 - 700
DTVSIQVDILSNNVPSDDVVSNTEEITFEALKKAIDTSGMEEQEKEKRRLVIEKFQKAPFEEIAAQCESK    701 - 770
ANLLHDRLAQILELTIRPPPSPSGTLTITSGHAQYQSVPVYEMKFPDLCVY                       771 - 821
//

Text Mined References (18)

PMID Year Title
26571211 2016 The leukodystrophy protein FAM126A (hyccin) regulates PtdIns(4)P synthesis at the plasma membrane.
25608530 2015 Plasticity of PI4KIII? interactions at the plasma membrane.
25380825 2015 EFR3s are palmitoylated plasma membrane proteins that control responsiveness to G-protein-coupled receptors.
24860643 2014 Rare deleterious mutations of the gene EFR3A in autism spectrum disorders.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23374588 2013 Pharmacogenomics in Alzheimer's disease: a genome-wide association study of response to cholinesterase inhibitors.
23229899 2012 PtdIns4P synthesis by PI4KIII? at the plasma membrane and its impact on plasma membrane identity.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
More...