Property Summary

NCBI Gene PubMed Count 10
PubMed Score 4.78
PubTator Score 0.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma -1.200 8.4e-03
Astrocytoma, Pilocytic -1.300 9.5e-06
atypical teratoid / rhabdoid tumor -1.700 1.9e-07
dermatomyositis 1.200 3.1e-04
ependymoma -1.300 7.5e-12
glioblastoma -1.200 4.2e-05
group 3 medulloblastoma -1.600 6.6e-03
hereditary spastic paraplegia -1.039 3.9e-02
lung cancer -1.200 4.9e-03
medulloblastoma, large-cell -1.600 9.8e-03
oligodendroglioma -1.100 2.7e-11
osteosarcoma 2.021 5.1e-05
ovarian cancer 1.400 2.6e-02
primitive neuroectodermal tumor -1.700 5.4e-06
psoriasis 1.100 6.2e-04
severe Alzheimer's disease -1.154 3.0e-02
Waldenstrons macroglobulinemia 1.262 4.8e-02

Gene RIF (2)

AA Sequence

MPTRVCCCCSALRPRYKRLVDNIFPEDPKDGLVKTDMEKLTFYAVSAPEKLDRIGSYLAERLSRDVVRHR      1 - 70
SGYVLIAMEALDQLLMACHSQSIKPFVESFLHMVAKLLESGEPKLQVLGTNSFVKFANIEEDTPSYHRRY     71 - 140
DFFVSRFSAMCHSCHSDPEIRTEIRIAGIRGIQGVVRKTVNDELRATIWEPQHMDKIVPSLLFNMQKIEE    141 - 210
VDSRIGPPSSPSATDKEENPAVLAENCFRELLGRATFGNMNNAVRPVFAHLDHHKLWDPNEFAVHCFKII    211 - 280
MYSIQAQYSHHVIQEILGHLDARKKDAPRVRAGIIQVLLEAVAIAAKGSIGPTVLEVFNTLLKHLRLSVE    281 - 350
FEANDLQGGSVGSVNLNTSSKDNDEKIVQNAIIQTIGFFGSNLPDYQRSEIMMFIMGKVPVFGTSTHTLD    351 - 420
ISQLGDLGTRRIQIMLLRSLLMVTSGYKAKTIVTALPGSFLDPLLSPSLMEDYELRQLVLEVMHNLMDRH    421 - 490
DNRAKLRGIRIIPDVADLKIKREKICRQDTSFMKKNGQQLYRHIYLGCKEEDNVQKNYELLYTSLALITI    491 - 560
ELANEEVVIDLIRLAIALQDSAIINEDNLPMFHRCGIMALVAAYLNFVSQMIAVPAFCQHVSKVIEIRTM    561 - 630
EAPYFLPEHIFRDKCMLPKSLEKHEKDLYFLTNKIAESLGGSGYSVERLSVPYVPQVTDEDRLSRRKSIV    631 - 700
DTVSIQVDILSNNVPSDDVVSNTEEITFEALKKAIDTSGMEEQEKEKRRLVIEKFQKAPFEEIAAQCESK    701 - 770
ANLLHDRLAQILELTIRPPPSPSGTLTITSGHAQYQSVPVYEMKFPDLCVY                       771 - 821
//

Text Mined References (18)

PMID Year Title