Property Summary

NCBI Gene PubMed Count 92
Grant Count 479
R01 Count 334
Funding $38,343,094.61
PubMed Score 139.08
PubTator Score 46.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Synonym

Accession Q14155 B1ALK6 B1ALK8 Q3LIA4 Q5W9H0 Q6P9G3 Q6PII2 Q86W63 Q8N3M1
Symbols P50
P85
PAK3
PIXB
COOL1
P50BP
COOL-1
P85SPR
BETA-PIX
P85COOL1
Nbla10314

Gene

PDB

1BY1   1ZSG   2L3G  

Gene RIF (38)

PMID Text
27012601 Data show association of G protein-coupled receptor kinase-interacting protein 1 (GIT1), p21-activated kinase interacting exchange factor (betaPIX), and p21 protein (Cdc42/Rac)-activated kinase 1 (PAK1) with centrosomes.
25683605 Data show the role of Rho guanine nucleotide exchange factor 7 (beta-PIX) to the regulation of high mobility of lung adenocarcinoma cell line H1299 via regulation of focal adhesions dynamics, changes in actin cytoskeleton organization and cell polarity.
25500533 Phosphorylation of LRRK2 by casein kinase 1alpha regulates trans-Golgi clustering via differential interaction with ARHGEF7.
25425573 Conversely, increased expression of betaPIX in breast cancer cell lines re-couples the Hippo kinase cassette to Yap/Taz, promoting localization of Yap/Taz to the cytoplasm and inhibiting cell migration and proliferation.
25284783 GIT1/betaPIX/Rac1/PAK pathway plays a crucial role in regulating GABA(A)R synaptic stability and hence inhibitory synaptic transmission with important implications for inhibitory plasticity and information processing in the brain.
25150978 The interaction of betaPix with srGAP1 is critical for maintaining suppressive crosstalk between Cdc42 and RhoA during 3D collagen migration.
24792722 BetaPix phosphorylation at Ser-340 upregulates Nox1 through Rac activation.
24458840 Data indicate that suppression of c-Cbl protein by rho guanine nucleotide exchange factor 7 (Cool-1) may be critical for generation of at least a subset of glioblastoma (GBM).
24129564 beta1Pix functions as a transcriptional regulator of beta-catenin signaling through direct interaction with beta-catenin, an action that may be functionally relevant to colon cancer biology.
23740575 BETA-PIX is a novel downstream signalling mediator during invadopodia formation.
More...

AA Sequence

MNSAEQTVTWLITLGVLESPKKTISDPEGFLQASLKDGVVLCRLLERLLPGTIEKVYPEPRSESECLSNI      1 - 70
REFLRGCGASLRLELLFPPSQPPQHLVTTILLSASTFDANDLYQGQNFNKVLSSLVTLNKVTADIGLGSD     71 - 140
SVCARPSSHRIKSFDSLGSQSLHTRTSKLFQGQYRSLDMTDNSNNQLVVRAKFNFQQTNEDELSFSKGDV    141 - 210
IHVTRVEEGGWWEGTLNGRTGWFPSNYVREVKASEKPVSPKSGTLKSPPKGFDTTAINKSYYNVVLQNIL    211 - 280
ETENEYSKELQTVLSTYLRPLQTSEKLSSANISYLMGNLEEICSFQQMLVQSLEECTKLPEAQQRVGGCF    281 - 350
LNLMPQMKTLYLTYCANHPSAVNVLTEHSEELGEFMETKGASSPGILVLTTGLSKPFMRLDKYPTLLKEL    351 - 420
ERHMEDYHTDRQDIQKSMAAFKNLSAQCQEVRKRKELELQILTEAIRNWEGDDIKTLGNVTYMSQVLIQC    421 - 490
AGSEEKNERYLLLFPNVLLMLSASPRMSGFIYQGKLPTTGMTITKLEDSENHRNAFEISGSMIERILVSC    491 - 560
NNQQDLQEWVEHLQKQTKVTSVGNPTIKPHSVPSHTLPSHPVTPSSKHADSKPAPLTPAYHTLPHPSHHG    561 - 630
TPHTTINWGPLEPPKTPKPWSLSCLRPAPPLRPSAALCYKEDLSKSPKTMKKLLPKRKPERKPSDEEFAS    631 - 700
RKSTAALEEDAQILKVIEAYCTSAKTRQTLNSTWQGTDLMHNHVLADDDQPSLDSLGRRSSLSRLEPSDL    701 - 770
SEDSDYDSIWTAHSYRMGSTSRKSCCSYISHQN                                         771 - 803
//

Text Mined References (104)

PMID Year Title
27012601 2016 GIT1/?PIX signaling proteins and PAK1 kinase regulate microtubule nucleation.
25683605 2015 ?-PIX controls intracellular viscoelasticity to regulate lung cancer cell migration.
25500533 2014 Phosphorylation of LRRK2 by casein kinase 1? regulates trans-Golgi clustering via differential interaction with ARHGEF7.
25425573 2014 Arhgef7 promotes activation of the Hippo pathway core kinase Lats.
25416956 2014 A proteome-scale map of the human interactome network.
25284783 2014 GIT1 and ?PIX are essential for GABA(A) receptor synaptic stability and inhibitory neurotransmission.
25150978 2014 An extracellular-matrix-specific GEF-GAP interaction regulates Rho GTPase crosstalk for 3D collagen migration.
24792722 2014 Nox1 activation by ?Pix and the role of Ser-340 phosphorylation.
24458840 2014 Cool-1-mediated inhibition of c-Cbl modulates multiple critical properties of glioblastomas, including the ability to generate tumors in vivo.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
More...