Property Summary

NCBI Gene PubMed Count 10
PubMed Score 59.02
PubTator Score 10.59

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8519 4.8e-07
osteosarcoma 7950 7.2e-05
cystic fibrosis 1695 4.6e-04
subependymal giant cell astrocytoma 2287 1.6e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Congenital syphilis 3 3.047 1.5
Asperger syndrome 37 3.018 1.5

Expression

  Differential Expression (4)

Disease log2 FC p
cystic fibrosis -1.100 4.6e-04
osteosarcoma -1.364 7.2e-05
ovarian cancer -1.500 4.8e-07
subependymal giant cell astrocytoma 1.453 1.6e-02

Gene RIF (2)

AA Sequence

MWRLPGLLGRALPRTLGPSLWRVTPKSTSPDGPQTTSSTLLVPVPNLDRSGPHGPGTSGGPRSHGWKDAF      1 - 70
QWMSSRVSPNTLWDAISWGTLAVLALQLARQIHFQASLPAGPQRVEHCSWHSPLDRFFSSPLWHPCSSLR     71 - 140
QHILPSPDGPAPRHTGLREPRLGQEEASAQPRNFSHNSLRGARPQDPSEEGPGDFGFLHASSSIESEAKP    141 - 210
AQPQPTGEKEQDKSKTLSLEEAVTSIQQLFQLSVSIAFNFLGTENMKSGDHTAAFSYFQKAAARGYSKAQ    211 - 280
YNAGLCHEHGRGTPRDISKAVLYYQLAASQGHSLAQYRYARCLLRDPASSWNPERQRAVSLLKQAADSGL    281 - 350
REAQAFLGVLFTKEPYLDEQRAVKYLWLAANNGDSQSRYHLGICYEKGLGVQRNLGEALRCYQQSAALGN    351 - 420
EAAQERLRALFSMGAAAPGPSDLTVTGLKSFSSPSLCSLNTLLAGTSRLPHASSTGNLGLLCRSGHLGAS    421 - 490
LEASSRAIPPHPYPLERSVVRLGFG                                                 491 - 515
//

Text Mined References (11)

PMID Year Title