Property Summary

NCBI Gene PubMed Count 9
PubMed Score 46.62
PubTator Score 16.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.497 0.000
lung adenocarcinoma -1.100 0.000

Gene RIF (2)

PMID Text
23958962 First study to identify risk variants for cocaine dependence using GWAS; rs2629540 at the FAM53B identified as a risk factor in African- and European-Americans
19727342 Strong candidate gene for age-related macular degeneration, ARMS2, (human 10q26.13). Conclusion is based on a massive expression data set for mouse (103 strains) and joint analysis of RetNet database.

AA Sequence

MVMVLSESLSTRGADSIACGTFSRELHTPKKMSQGPTLFSCGIMENDRWRDLDRKCPLQIDQPSTSIWEC      1 - 70
LPEKDSSLWHREAVTACAVTSLIKDLSISDHNGNPSAPPSKRQCRSLSFSDEMSSCRTSWRPLGSKVWTP     71 - 140
VEKRRCYSGGSVQRYSNGFSTMQRSSSFSLPSRANVLSSPCDQAGLHHRFGGQPCQGVPGSAPCGQAGDT    141 - 210
WSPDLHPVGGGRLDLQRSLSCSHEQFSFVEYCPPSANSTPASTPELARRSSGLSRSRSQPCVLNDKKVGV    211 - 280
KRRRPEEVQEQRPSLDLAKMAQNCQTFSSLSCLSAGTEDCGPQSPFARHVSNTRAWTALLSASGPGGRTP    281 - 350
AGTPVPEPLPPSFDDHLACQEDLSCEESDSCALDEDCGRRAEPAAAWRDRGAPGNSLCSLDGELDIEQIE    351 - 420
KN                                                                        421 - 422
//

Text Mined References (12)

PMID Year Title
23958962 2014 Genome-wide association study of cocaine dependence and related traits: FAM53B identified as a risk gene.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
19727342 2009 Gene expression in the mouse eye: an online resource for genetics using 103 strains of mice.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16611694 2006 Medaka simplet (FAM53B) belongs to a family of novel vertebrate genes controlling cell proliferation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...