Property Summary

NCBI Gene PubMed Count 9
PubMed Score 46.62
PubTator Score 16.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Cocaine dependence 24
Disease Target Count P-value
lung adenocarcinoma 2714 4.60333725359792E-11
osteosarcoma 7933 1.79804902417276E-5
Disease Target Count Z-score Confidence
Schistosomiasis 38 3.275 1.6
Pontocerebellar hypoplasia 29 3.085 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.497 0.000
lung adenocarcinoma -1.100 0.000

Synonym

Accession Q14153 D3DRF1 Q5VUW1 Q5VUW2 Q8N5S6
Symbols smp
KIAA0140
bA12J10.2

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG
Opossum EggNOG Inparanoid
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid

 Compartment GO Term (2)

 GWAS Trait (1)

Pathway (1)

Gene RIF (2)

PMID Text
23958962 First study to identify risk variants for cocaine dependence using GWAS; rs2629540 at the FAM53B identified as a risk factor in African- and European-Americans
19727342 Strong candidate gene for age-related macular degeneration, ARMS2, (human 10q26.13). Conclusion is based on a massive expression data set for mouse (103 strains) and joint analysis of RetNet database.

AA Sequence

MVMVLSESLSTRGADSIACGTFSRELHTPKKMSQGPTLFSCGIMENDRWRDLDRKCPLQIDQPSTSIWEC      1 - 70
LPEKDSSLWHREAVTACAVTSLIKDLSISDHNGNPSAPPSKRQCRSLSFSDEMSSCRTSWRPLGSKVWTP     71 - 140
VEKRRCYSGGSVQRYSNGFSTMQRSSSFSLPSRANVLSSPCDQAGLHHRFGGQPCQGVPGSAPCGQAGDT    141 - 210
WSPDLHPVGGGRLDLQRSLSCSHEQFSFVEYCPPSANSTPASTPELARRSSGLSRSRSQPCVLNDKKVGV    211 - 280
KRRRPEEVQEQRPSLDLAKMAQNCQTFSSLSCLSAGTEDCGPQSPFARHVSNTRAWTALLSASGPGGRTP    281 - 350
AGTPVPEPLPPSFDDHLACQEDLSCEESDSCALDEDCGRRAEPAAAWRDRGAPGNSLCSLDGELDIEQIE    351 - 420
KN                                                                        421 - 422
//

Text Mined References (12)

PMID Year Title
23958962 2014 Genome-wide association study of cocaine dependence and related traits: FAM53B identified as a risk gene.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
19727342 2009 Gene expression in the mouse eye: an online resource for genetics using 103 strains of mice.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16611694 2006 Medaka simplet (FAM53B) belongs to a family of novel vertebrate genes controlling cell proliferation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...