Property Summary

NCBI Gene PubMed Count 78
Grant Count 63
R01 Count 50
Funding $5,622,573.05
PubMed Score 174.76
PubTator Score 297.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Multiple myeloma 1.624 0.001
osteosarcoma -1.517 0.000
astrocytoma 1.100 0.009
medulloblastoma, large-cell 1.600 0.000
hereditary spastic paraplegia -1.194 0.008
Amyotrophic Lateral Sclerosis 1.063 0.000
acute quadriplegic myopathy 1.406 0.000
group 3 medulloblastoma 1.100 0.011
ovarian cancer 2.500 0.000
dermatomyositis 1.100 0.001

Synonym

Accession Q14152 B1AMV5 B4DYS1 F5H335 O00653 Q15778 eIF3a
Symbols EIF3
P167
p180
p185
TIF32
EIF3S10
eIF3-p170
eIF3-theta

Gene

PDB

3J8B   3J8C  

Gene RIF (43)

PMID Text
26213845 eIF3a improves ovarian cancer patients' response to cisplatin-based chemotherapy by down regulating XPC and p27(Kip1).
26172298 eIF3 has a role in controlling cell size independently of S6K1-activity
25898924 Collybistin forms a complex with mTOR and eIF3 and by sequestering these proteins downregulates mTORC1 signaling and protein synthesis potentially contributing to intellectual disability and autism.
25732572 eIF3a SNPs are significantly correlated with platinum-based chemotherapy toxicities in Chinese non-small cell lung carcinoma patients.
25509353 At 37 degrees C, P185(HER2) internalized through coated pits and vesicles and concentrated in the endosomes and multivesicular bodies in the cells of both cell lines, as well as in lysosomes in cells BT-474
25070653 Data conclude that eIF3a expression may have a profound effect on the urinary bladder cancer phenotype and, in addition, may serve as a prognostic marker for low grade UBCs.
24912683 eIF3a and eIF3c control abundance and assembly of the entire eIF3 and thus represent its crucial scaffolding elements critically required for formation of preinitiation complexes.
24789280 findings suggested altered eIF3a expression closely correlated with p27 status, and the association was of prognostic value for resected NSCLC
24396066 The Paip1-eIF3 interaction is impaired by the mTORC1 inhibitors.
24386425 Of the total, the deregulation of several genes (CDK1, CDK2, CDK4, MCM2, MCM3, MCM4, EIF3a and RPN2) were potentially associated with disease development and progression.
More...

AA Sequence

MPAYFQRPENALKRANEFLEVGKKQPALDVLYDVMKSKKHRTWQKIHEPIMLKYLELCVDLRKSHLAKEG      1 - 70
LYQYKNICQQVNIKSLEDVVRAYLKMAEEKTEAAKEESQQMVLDIEDLDNIQTPESVLLSAVSGEDTQDR     71 - 140
TDRLLLTPWVKFLWESYRQCLDLLRNNSRVERLYHDIAQQAFKFCLQYTRKAEFRKLCDNLRMHLSQIQR    141 - 210
HHNQSTAINLNNPESQSMHLETRLVQLDSAISMELWQEAFKAVEDIHGLFSLSKKPPKPQLMANYYNKVS    211 - 280
TVFWKSGNALFHASTLHRLYHLSREMRKNLTQDEMQRMSTRVLLATLSIPITPERTDIARLLDMDGIIVE    281 - 350
KQRRLATLLGLQAPPTRIGLINDMVRFNVLQYVVPEVKDLYNWLEVEFNPLKLCERVTKVLNWVREQPEK    351 - 420
EPELQQYVPQLQNNTILRLLQQVSQIYQSIEFSRLTSLVPFVDAFQLERAIVDAARHCDLQVRIDHTSRT    421 - 490
LSFGSDLNYATREDAPIGPHLQSMPSEQIRNQLTAMSSVLAKALEVIKPAHILQEKEEQHQLAVTAYLKN    491 - 560
SRKEHQRILARRQTIEERKERLESLNIQREKEELEQREAELQKVRKAEEERLRQEAKEREKERILQEHEQ    561 - 630
IKKKTVRERLEQIKKTELGAKAFKDIDIEDLEELDPDFIMAKQVEQLEKEKKELQERLKNQEKKIDYFER    631 - 700
AKRLEEIPLIKSAYEEQRIKDMDLWEQQEEERITTMQLEREKALEHKNRMSRMLEDRDLFVMRLKAARQS    701 - 770
VYEEKLKQFEERLAEERHNRLEERKRQRKEERRITYYREKEEEEQRRAEEQMLKEREERERAERAKREEE    771 - 840
LREYQERVKKLEEVERKKRQRELEIEERERRREEERRLGDSSLSRKDSRWGDRDSEGTWRKGPEADSEWR    841 - 910
RGPPEKEWRRGEGRDEDRSHRRDEERPRRLGDDEDREPSLRPDDDRVPRRGMDDDRGPRRGPEEDRFSRR    911 - 980
GADDDRPSWRNTDDDRPPRRIADEDRGNWRHADDDRPPRRGLDEDRGSWRTADEDRGPRRGMDDDRGPRR    981 - 1050
GGADDERSSWRNADDDRGPRRGLDDDRGPRRGMDDDRGPRRGMDDDRGPRRGMDDDRGPRRGLDDDRGPW   1051 - 1120
RNADDDRIPRRGAEDDRGPWRNMDDDRLSRRADDDRFPRRGDDSRPGPWRPLVKPGGWREKEKAREESWG   1121 - 1190
PPRESRPSEEREWDREKERDRDNQDREENDKDPERERDRERDVDREDRFRRPRDEGGWRRGPAEESSSWR   1191 - 1260
DSSRRDDRDRDDRRRERDDRRDLRERRDLRDDRDRRGPPLRSEREEVSSWRRADDRKDDRVEERDPPRRV   1261 - 1330
PPPALSRDRERDRDREREGEKEKASWRAEKDRESLRRTKNETDEDGWTTVRR                     1331 - 1382
//

Text Mined References (92)

PMID Year Title
27462815 2016 eIF3d is an mRNA cap-binding protein that is required for specialized translation initiation.
26213845 2015 eIF3a improve cisplatin sensitivity in ovarian cancer by regulating XPC and p27Kip1 translation.
26172298 2015 eIF3 controls cell size independently of S6K1-activity.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25898924 2016 Collybistin binds and inhibits mTORC1 signaling: a potential novel mechanism contributing to intellectual disability and autism.
25849773 2015 eIF3 targets cell-proliferation messenger RNAs for translational activation or repression.
25732572 2015 Association of positively selected eIF3a polymorphisms with toxicity of platinum-based chemotherapy in NSCLC patients.
25509353 [Immunocytochemical visualization of P185(HER2) receptor by antibody fused with dibarnase and conjugate of barstar with colloidal gold].
25070653 2014 eIF3a is over-expressed in urinary bladder cancer and influences its phenotype independent of translation initiation.
24912683 2014 Functional and biochemical characterization of human eukaryotic translation initiation factor 3 in living cells.
More...