Property Summary

NCBI Gene PubMed Count 20
PubMed Score 4.92
PubTator Score 9.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 6.9e-08
Multiple myeloma 1332 9.7e-05
astrocytoma 1146 9.2e-04
medulloblastoma, large-cell 6241 1.3e-03
dermatomyositis 966 1.5e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Disease Target Count Z-score Confidence
Cardiovascular system disease 246 0.0 0.7

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytoma 1.800 9.2e-04
dermatomyositis 1.200 1.5e-03
medulloblastoma, large-cell -1.100 1.3e-03
Multiple myeloma 1.099 9.7e-05
ovarian cancer -1.500 6.9e-08

Gene RIF (7)

AA Sequence

MAETLPGSGDSGPGTASLGPGVAETGTRRLSELRVIDLRAELKKRNLDTGGNKSVLMERLKKAVKEEGQD      1 - 70
PDEIGIELEATSKKSAKRCVKGLKMEEEGTEDNGLEDDSRDGQEDMEASLENLQNMGMMDMSVLDETEVA     71 - 140
NSSAPDFGEDGTDGLLDSFCDSKEYVAAQLRQLPAQPPEHAVDGEGFKNTLETSSLNFKVTPDIEESLLE    141 - 210
PENEKILDILGETCKSEPVKEESSELEQPFAQDTSSVGPDRKLAEEEDLFDSAHPEEGDLDLASESTAHA    211 - 280
QSSKADSLLAVVKREPAEQPGDGERTDCEPVGLEPAVEQSSAASELAEASSEELAEAPTEAPSPEARDSK    281 - 350
EDGRKFDFDACNEVPPAPKESSTSEGADQKMSSFKEEKDIKPIIKDEKGRVGSGSGRNLWVSGLSSTTRA    351 - 420
TDLKNLFSKYGKVVGAKVVTNARSPGARCYGFVTMSTSDEATKCISHLHRTELHGRMISVEKAKNEPAGK    421 - 490
KLSDRKECEVKKEKLSSVDRHHSVEIKIEKTVIKKEEKIEKKEEKKPEDIKKEEKDQDELKPGPTNRSRV    491 - 560
TKSGSRGMERTVVMDKSKGEPVISVKTTSRSKERSSKSQDRKSESKEKRDILSFDKIKEQRERERQRQRE    561 - 630
REIRETERRREREQREREQRLEAFHERKEKARLQRERLQLECQRQRLERERMERERLERERMRVERERRK    631 - 700
EQERIHREREELRRQQEQLRYEQERRPGRRPYDLDRRDDAYWPEGKRVAMEDRYRADFPRPDHRFHDFDH    701 - 770
RDRGQYQDHAIDRREGSRPMMGDHRDGQHYGDDRHGHGGPPERHGRDSRDGWGGYGSDKRLSEGRGLPPP    771 - 840
PRGGRDWGEHNQRLEEHQARAWQGAMDAGAASREHARWQGGERGLSGPSGPGHMASRGGVAGRGGFAQGG    841 - 910
HSQGHVVPGGGLEGGGVASQDRGSRVPHPHPHPPPYPHFTRRY                               911 - 953
//

Text Mined References (39)

PMID Year Title