Property Summary

NCBI Gene PubMed Count 12
PubMed Score 5.95
PubTator Score 2.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 7.14392255832197E-14
juvenile dermatomyositis 1189 7.58988883603712E-12
oligodendroglioma 2849 6.37000949681038E-10
glioblastoma 5572 1.858145040007E-9
pilocytic astrocytoma 3086 4.37789467663968E-9
ovarian cancer 8492 3.44666896948559E-8
malignant mesothelioma 3163 1.13061059790251E-6
psoriasis 6685 6.19433510524638E-5
lung cancer 4473 7.64486203483888E-5
cutaneous lupus erythematosus 1056 9.67595112936483E-5
adult high grade glioma 2148 1.0451741352052E-4
posterior fossa group A ependymoma 1511 1.1018514109512E-4
invasive ductal carcinoma 2950 2.86256900057142E-4
tuberculosis 1563 3.14025467402854E-4
primary Sjogren syndrome 789 4.58972110937629E-4
pancreatic cancer 2300 0.00124644882860813
group 4 medulloblastoma 1875 0.00142328122014155
ductal carcinoma in situ 1745 0.00775327752005178
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0112370730070155
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0150329150496246
Waldenstrons macroglobulinemia 765 0.0171470607550399
astrocytoma 1493 0.0177211245080895
colon cancer 1475 0.0247564052164584
Rheumatoid Arthritis 1171 0.0367505969066433
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0466589748200378

Expression

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse EggNOG Inparanoid
Cow OMA EggNOG
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (3)

PMID Text
25948474 stable enhanced expression of trim14 gene in cells activates the transcription of many immunity genes and suppresses Sindbis virus reproduction, but Sindbis virus infection of HEK-trim14 cells promotes inhibition of some genes involved in innate immunity.
24379373 Upon virus infection, TRIM14 recruits NF-kappaB essential modulator (NEMO) to the MAVS complex via ubiquitin chains.
18978678 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAGAATGSRTPGRSELVEGCGWRCPEHGDRVAELFCRRCRRCVCALCPVLGAHRGHPVGLALEAAVHVQK      1 - 70
LSQECLKQLAIKKQQHIDNITQIEDATEKLKANAESSKTWLKGKFTELRLLLDEEEALAKKFIDKNTQLT     71 - 140
LQVYREQADSCREQLDIMNDLSNRVWSISQEPDPVQRLQAYTATEQEMQQQMSLGELCHPVPLSFEPVKS    141 - 210
FFKGLVEAVESTLQTPLDIRLKESINCQLSDPSSTKPGTLLKTSPSPERSLLLKYARTPTLDPDTMHARL    211 - 280
RLSADRLTVRCGLLGSLGPVPVLRFDALWQVLARDCFATGRHYWEVDVQEAGAGWWVGAAYASLRRRGAS    281 - 350
AAARLGCNRQSWCLKRYDLEYWAFHDGQRSRLRPRDDLDRLGVFLDYEAGVLAFYDVTGGMSHLHTFRAT    351 - 420
FQEPLYPALRLWEGAISIPRLP                                                    421 - 442
//

Text Mined References (13)

PMID Year Title
25948474 2015 Enhanced expression of trim14 gene suppressed Sindbis virus reproduction and modulated the transcription of a large number of genes of innate immunity.
24379373 2014 TRIM14 is a mitochondrial adaptor that facilitates retinoic acid-inducible gene-I-like receptor-mediated innate immune response.
23077300 2013 TRIM protein-mediated regulation of inflammatory and innate immune signaling and its association with antiretroviral activity.
22711689 2012 Identification of type I and type II interferon-induced effectors controlling hepatitis C virus replication.
18978678 2008 Candidate gene/loci studies in cleft lip/palate and dental anomalies finds novel susceptibility genes for clefts.
18248090 2008 TRIM E3 ligases interfere with early and late stages of the retroviral life cycle.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...