Property Summary

NCBI Gene PubMed Count 31
Grant Count 5
Funding $743,729.95
PubMed Score 90.94
PubTator Score 61.78

Knowledge Summary

Patent

No data available

Expression

 GO Function (1)

Gene RIF (11)

PMID Text
25519054 MiR-223-3p might target gene SEPT6 and promoted the biological behavior of prostate cancer.
25380047 Septin6 and Septin7 GTP binding proteins regulate AP-3- and ESCRT-dependent multivesicular body biogenesis
21788367 The SEPT6 provides the directional guidance cues necessary for polarizing the epithelial microtubule network.
21082023 Data show that Septins of the SEPT6 group preferentially interacted with septins of the SEPT2 group, SEPT3 group and SEPT7 group.
18047794 co-expression of SEPT12 altered the filamentous structure of SEPT6 in Hela cells
17803907 Demonstrate connection between septins/SOCS7/NCK signaling and the DNA damage response.
17637674 crystal structures of the human SEPT2 G domain and the heterotrimeric human SEPT2-SEPT6-SEPT7 complex
17229681 These results indicate that the host proteins hnRNP A1 and septin 6 play important roles in the replication of HCV through RNA-protein and protein-protein interactions.
16914550 septin 2, 6, and 7 complexes make up polymerized filaments
16843108 Molecular analysis using rtPCR followed by sequencing confirmed the expression of an MLL-SEPT6 fusion transcript with a novel sequence.
More...

AA Sequence

MAATDIARQVGEGCRTVPLAGHVGFDSLPDQLVNKSVSQGFCFNILCVGETGLGKSTLMDTLFNTKFEGE      1 - 70
PATHTQPGVQLQSNTYDLQESNVRLKLTIVSTVGFGDQINKEDSYKPIVEFIDAQFEAYLQEELKIRRVL     71 - 140
HTYHDSRIHVCLYFIAPTGHSLKSLDLVTMKKLDSKVNIIPIIAKADAISKSELTKFKIKITSELVSNGV    141 - 210
QIYQFPTDDESVAEINGTMNAHLPFAVIGSTEELKIGNKMMRARQYPWGTVQVENEAHCDFVKLREMLIR    211 - 280
VNMEDLREQTHTRHYELYRRCKLEEMGFKDTDPDSKPFSLQETYEAKRNEFLGELQKKEEEMRQMFVQRV    281 - 350
KEKEAELKEAEKELHEKFDRLKKLHQDEKKKLEDKKKSLDDEVNAFKQRKTAAELLQSQGSQAGGSQTLK    351 - 420
RDKEKKNNPWLCTE                                                            421 - 434
//

Text Mined References (42)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25775403 2015 SEPT12/SPAG4/LAMINB1 complexes are required for maintaining the integrity of the nuclear envelope in postmeiotic male germ cells.
25588830 2015 SEPT12 orchestrates the formation of mammalian sperm annulus by organizing core octameric complexes with other SEPT proteins.
25519054 2014 MiR-223-3p targeting SEPT6 promotes the biological behavior of prostate cancer.
25416956 2014 A proteome-scale map of the human interactome network.
25380047 2014 Septin6 and Septin7 GTP binding proteins regulate AP-3- and ESCRT-dependent multivesicular body biogenesis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21788367 2011 Septin GTPases spatially guide microtubule organization and plus end dynamics in polarizing epithelia.
More...