Property Summary

NCBI Gene PubMed Count 34
PubMed Score 96.67
PubTator Score 61.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (29)

Disease log2 FC p
adult high grade glioma -1.500 3.7e-04
astrocytic glioma -1.600 2.3e-02
Astrocytoma, Pilocytic 1.300 2.6e-05
atypical teratoid / rhabdoid tumor 1.400 1.5e-04
colon cancer -2.000 1.4e-02
cutaneous lupus erythematosus 1.500 1.9e-03
ductal carcinoma in situ 1.800 1.5e-03
ependymoma -1.600 4.5e-02
glioblastoma 1.100 1.2e-04
group 3 medulloblastoma 1.800 2.8e-03
interstitial cystitis 1.800 3.6e-03
intraductal papillary-mucinous carcinoma... -1.800 5.2e-03
invasive ductal carcinoma 1.118 1.6e-03
lung cancer -2.000 6.5e-04
malignant mesothelioma 1.200 1.2e-06
medulloblastoma, large-cell 2.000 7.4e-06
oligodendroglioma -2.000 7.3e-03
osteosarcoma -1.434 3.8e-02
ovarian cancer 1.500 1.6e-03
pancreatic cancer 1.600 1.8e-03
periodontitis 1.100 5.3e-23
Pick disease -1.300 1.2e-02
primary pancreatic ductal adenocarcinoma 2.108 1.3e-04
primary Sjogren syndrome 1.600 4.9e-04
primitive neuroectodermal tumor 1.500 5.6e-03
psoriasis -1.300 1.8e-04
subependymal giant cell astrocytoma 1.598 3.3e-02
ulcerative colitis 2.300 1.3e-05
Waldenstrons macroglobulinemia 1.625 3.2e-02

 GO Function (1)

Gene RIF (12)

AA Sequence

MAATDIARQVGEGCRTVPLAGHVGFDSLPDQLVNKSVSQGFCFNILCVGETGLGKSTLMDTLFNTKFEGE      1 - 70
PATHTQPGVQLQSNTYDLQESNVRLKLTIVSTVGFGDQINKEDSYKPIVEFIDAQFEAYLQEELKIRRVL     71 - 140
HTYHDSRIHVCLYFIAPTGHSLKSLDLVTMKKLDSKVNIIPIIAKADAISKSELTKFKIKITSELVSNGV    141 - 210
QIYQFPTDDESVAEINGTMNAHLPFAVIGSTEELKIGNKMMRARQYPWGTVQVENEAHCDFVKLREMLIR    211 - 280
VNMEDLREQTHTRHYELYRRCKLEEMGFKDTDPDSKPFSLQETYEAKRNEFLGELQKKEEEMRQMFVQRV    281 - 350
KEKEAELKEAEKELHEKFDRLKKLHQDEKKKLEDKKKSLDDEVNAFKQRKTAAELLQSQGSQAGGSQTLK    351 - 420
RDKEKKNNPWLCTE                                                            421 - 434
//

Text Mined References (45)

PMID Year Title