Property Summary

NCBI Gene PubMed Count 12
PubMed Score 6.48
PubTator Score 6.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
juvenile dermatomyositis 1189 2.23677172206498E-11
malignant mesothelioma 3163 1.22297098732511E-6
ovarian cancer 8492 7.82410888449723E-5
pituitary cancer 1972 0.00125930007350985
osteosarcoma 7933 0.00139837046589771
acute myeloid leukemia 785 0.00329053239408728
spina bifida 1064 0.0357719956073388
astrocytoma 1493 0.0366456989075109
Multiple myeloma 1328 0.0375582313733417
Waldenstrons macroglobulinemia 765 0.0396691226878953

Expression

  Differential Expression (10)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.268 0.040
Multiple myeloma 1.173 0.038
malignant mesothelioma 1.100 0.000
osteosarcoma -1.595 0.001
astrocytoma 1.100 0.037
juvenile dermatomyositis 1.147 0.000
spina bifida -1.392 0.036
acute myeloid leukemia 1.200 0.003
ovarian cancer 1.700 0.000
pituitary cancer -1.200 0.001

Synonym

Accession Q14140 Q53TS2
Symbols Sei-2
TRIP-Br2

Gene

PANTHER Protein Class (1)

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid

Pathway (1)

Gene RIF (4)

PMID Text
23291629 TRIP-Br2, modulates fat storage through simultaneous regulation of lipolysis, thermogenesis and oxidative metabolism.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19152710 TRIP-Br2 is frequently overexpressed in both cancer cell lines and multiple human tumors.
18316374 CRM1-mediated nuclear export may be required for the proper execution of ubiquitin-proteasome-dependent degradation of TRIP-Br2

AA Sequence

MLGKGGKRKFDEHEDGLEGKIVSPCDGPSKVSYTLQRQTIFNISLMKLYNHRPLTEPSLQKTVLINNMLR      1 - 70
RIQEELKQEGSLRPMFTPSSQPTTEPSDSYREAPPAFSHLASPSSHPCDLGSTTPLEACLTPASLLEDDD     71 - 140
DTFCTSQAMQPTAPTKLSPPALLPEKDSFSSALDEIEELCPTSTSTEAATAATDSVKGTSSEAGTQKLDG    141 - 210
PQESRADDSKLMDSLPGNFEITTSTGFLTDLTLDDILFADIDTSMYDFDPCTSSSGTASKMAPVSADDLL    211 - 280
KTLAPYSSQPVTPSQPFKMDLTELDHIMEVLVGS                                        281 - 314
//

Text Mined References (12)

PMID Year Title
23291629 2013 Ablation of TRIP-Br2, a regulator of fat lipolysis, thermogenesis and oxidative metabolism, prevents diet-induced obesity and insulin resistance.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19152710 2009 TRIP-Br2 promotes oncogenesis in nude mice and is frequently overexpressed in multiple human tumors.
18316374 2008 CRM1-mediated nuclear export is required for 26 S proteasome-dependent degradation of the TRIP-Br2 proto-oncoprotein.
16098148 2005 SEI family of nuclear factors regulates p53-dependent transcriptional activation.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...