Property Summary

NCBI Gene PubMed Count 12
PubMed Score 7.35
PubTator Score 6.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (10)

Disease log2 FC p
acute myeloid leukemia 1.200 3.3e-03
astrocytoma 1.100 3.7e-02
juvenile dermatomyositis 1.147 2.2e-11
malignant mesothelioma 1.100 1.2e-06
Multiple myeloma 1.173 3.8e-02
osteosarcoma -1.595 1.4e-03
ovarian cancer 1.700 7.8e-05
pituitary cancer -1.100 2.1e-05
spina bifida -1.392 3.6e-02
Waldenstrons macroglobulinemia 1.268 4.0e-02

Synonym

Accession Q14140 Q53TS2
Symbols Sei-2
TRIP-Br2

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (4)

AA Sequence

MLGKGGKRKFDEHEDGLEGKIVSPCDGPSKVSYTLQRQTIFNISLMKLYNHRPLTEPSLQKTVLINNMLR      1 - 70
RIQEELKQEGSLRPMFTPSSQPTTEPSDSYREAPPAFSHLASPSSHPCDLGSTTPLEACLTPASLLEDDD     71 - 140
DTFCTSQAMQPTAPTKLSPPALLPEKDSFSSALDEIEELCPTSTSTEAATAATDSVKGTSSEAGTQKLDG    141 - 210
PQESRADDSKLMDSLPGNFEITTSTGFLTDLTLDDILFADIDTSMYDFDPCTSSSGTASKMAPVSADDLL    211 - 280
KTLAPYSSQPVTPSQPFKMDLTELDHIMEVLVGS                                        281 - 314
//

Text Mined References (12)

PMID Year Title