Property Summary

NCBI Gene PubMed Count 24
PubMed Score 11.17
PubTator Score 9.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung adenocarcinoma 2714 2.14805534415626E-12
osteosarcoma 7933 9.48175862478123E-8
ovarian cancer 8492 1.66125617925027E-7
Pick disease 1893 5.64643469606016E-7
lung cancer 4473 3.38177059210642E-6
pituitary cancer 1972 1.49903410414E-4
psoriasis 6685 2.19652436859713E-4
glioblastoma 5572 0.00386263930198118
astrocytoma 1493 0.00394166444966208
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00502551004192975
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0077874347144114
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0154382609061435
subependymal giant cell astrocytoma 2287 0.0226437155019539
Alzheimer's disease 644 0.0235555518871833

Expression

  Differential Expression (14)

Synonym

Accession Q14135 B4DTS7 J3KN68 Q7L5V0 Q9BQ78 Vgl-4
Symbols VGL-4

Gene

  Ortholog (9)

Pathway (1)

Gene RIF (14)

PMID Text
26460480 VGLL4 - novel candidate genes validated in a large case-control sample of schizophrenia.
25701461 The expression level of VGLL4 protein was down-regulated in gastric cancer tissues.VGLL4 inhibits epithelial-mesenchymal transition in part through suppressing Wnt-beta-catenin signaling pathway in gastric cancer.
25352025 our study suggested that downregulation of VGLL4 was very important in the progression of ESCC, and restoring the function of VGLL4 might be a promising therapeutic strategy for ESCC.
24983835 rs2616551 in VGLL4 was found to be nominally associated with anorexia nervosa.
24525233 Loss of VGLL4 expression is associated with gastric cancer.
24458094 VGLL4 directly competes with YAP in binding to TEADs and executes its growth-inhibitory function through two TDU domains.
23765749 This study introduces a novel gain-of-function approach for studying hESC maintenance and presents VGLL4 as a previously undescribed regulator of this process.
21839727 Vgl-4 may play a role in the apoptotic pathways by regulating translocation of IAPs between different cell compartments.
20702774 IRF2BP2 was identifies as a novel VGLL4 partner.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

METPLDVLSRAASLVHADDEKREAALRGEPRMQTLPVASALSSHRTGPPPISPSKRKFSMEPGDEDLDCD      1 - 70
NDHVSKMSRIFNPHLNKTANGDCRRDPRERSRSPIERAVAPTMSLHGSHLYTSLPSLGLEQPLALTKNSL     71 - 140
DASRPAGLSPTLTPGERQQNRPSVITCASAGARNCNLSHCPIAHSGCAAPGPASYRRPPSAATTCDPVVE    141 - 210
EHFRRSLGKNYKEPEPAPNSVSITGSVDDHFAKALGDTWLQIKAAKDGASSSPESASRRGQPASPSAHMV    211 - 280
SHSHSPSVVS                                                                281 - 290
//

Text Mined References (30)

PMID Year Title
26460480 2015 Expression analysis in a rat psychosis model identifies novel candidate genes validated in a large case-control sample of schizophrenia.
25701461 2015 VGLL4 inhibits EMT in part through suppressing Wnt/?-catenin signaling pathway in gastric cancer.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
25352025 2015 Downregulation of VGLL4 in the progression of esophageal squamous cell carcinoma.
24983835 2014 Characterization of genetic variation in the VGLL4 gene in anorexia nervosa.
24525233 2014 A peptide mimicking VGLL4 function acts as a YAP antagonist therapy against gastric cancer.
24458094 2014 VGLL4 functions as a new tumor suppressor in lung cancer by negatively regulating the YAP-TEAD transcriptional complex.
24068947 2013 Common variants in left/right asymmetry genes and pathways are associated with relative hand skill.
23765749 2013 Brief report: VGLL4 is a novel regulator of survival in human embryonic stem cells.
23319000 2014 Genome-wide association study of monoamine metabolite levels in human cerebrospinal fluid.
More...