Property Summary

NCBI Gene PubMed Count 25
PubMed Score 13.79
PubTator Score 9.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Alzheimer's disease 1.100 2.4e-02
astrocytoma 1.600 3.9e-03
glioblastoma 1.300 3.9e-03
intraductal papillary-mucinous carcinoma... 1.100 5.0e-03
intraductal papillary-mucinous neoplasm ... 1.500 7.8e-03
lung adenocarcinoma 1.100 2.1e-12
lung cancer 1.800 1.7e-04
osteosarcoma 3.167 9.5e-08
ovarian cancer 2.300 1.5e-04
pancreatic ductal adenocarcinoma liver m... 1.179 6.0e-03
Pick disease 1.700 5.6e-07
pituitary cancer -1.200 1.5e-04
psoriasis -1.400 2.2e-04
subependymal giant cell astrocytoma 1.213 3.6e-03

Protein-protein Interaction (7)

Gene RIF (15)

AA Sequence

METPLDVLSRAASLVHADDEKREAALRGEPRMQTLPVASALSSHRTGPPPISPSKRKFSMEPGDEDLDCD      1 - 70
NDHVSKMSRIFNPHLNKTANGDCRRDPRERSRSPIERAVAPTMSLHGSHLYTSLPSLGLEQPLALTKNSL     71 - 140
DASRPAGLSPTLTPGERQQNRPSVITCASAGARNCNLSHCPIAHSGCAAPGPASYRRPPSAATTCDPVVE    141 - 210
EHFRRSLGKNYKEPEPAPNSVSITGSVDDHFAKALGDTWLQIKAAKDGASSSPESASRRGQPASPSAHMV    211 - 280
SHSHSPSVVS                                                                281 - 290
//

Text Mined References (31)

PMID Year Title