Property Summary

NCBI Gene PubMed Count 48
Grant Count 32
R01 Count 9
Funding $7,249,389
PubMed Score 28.49
PubTator Score 32.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Gene RIF (27)

PMID Text
26471361 Findings established a role for ATDC/TRIM29 as a robust pathogenic driver of bladder cancer development, identified downstream effector pathways, and implicated ATDC as a candidate biomarker and therapeutic target.
26381412 define a novel function for ATDC in the RNF8-mediated DNA damage response and implicate RNF8 binding as a key determinant of the radioprotective function of ATDC
26191199 Results suggest that TRIM29 functions as an oncogene in gastric cancer and is regulated by miR-185.
26095369 TRIM29 functions as a scaffold protein to assemble DNA repair proteins into chromatin followed by efficient activation of DNA damage response.
26071105 These findings suggest that TRIM29 regulates the p63-mediated pathway and the behavior of cervical cancer cells.
25491629 Down-regulation of ATDC inhibits the growth and proliferation of esophageal carcinoma cells.
24950909 TWIST1 inhibited TRIM29 promoter activity.
24864129 TRIM29 promotes tumor progression and may be a novel prognostic marker for pancreatic ductal adenocarcinoma.
24485335 TRIM29 may be useful marker for distinguishing prostate cancers from benign tissues
24469230 Ataxia-telangiectasia group D-associated gene (ATDC) mediates resistance to ionizing radiation.
More...

AA Sequence

MEAADASRSNGSSPEARDARSPSGPSGSLENGTKADGKDAKTTNGHGGEAAEGKSLGSALKPGEGRSALF      1 - 70
AGNEWRRPIIQFVESGDDKNSNYFSMDSMEGKRSPYAGLQLGAAKKPPVTFAEKGELRKSIFSESRKPTV     71 - 140
SIMEPGETRRNSYPRADTGLFSRSKSGSEEVLCDSCIGNKQKAVKSCLVCQASFCELHLKPHLEGAAFRD    141 - 210
HQLLEPIRDFEARKCPVHGKTMELFCQTDQTCICYLCMFQEHKNHSTVTVEEAKAEKETELSLQKEQLQL    211 - 280
KIIEIEDEAEKWQKEKDRIKSFTTNEKAILEQNFRDLVRDLEKQKEEVRAALEQREQDAVDQVKVIMDAL    281 - 350
DERAKVLHEDKQTREQLHSISDSVLFLQEFGALMSNYSLPPPLPTYHVLLEGEGLGQSLGNFKDDLLNVC    351 - 420
MRHVEKMCKADLSRNFIERNHMENGGDHRYVNNYTNSFGGEWSAPDTMKRYSMYLTPKGGVRTSYQPSSP    421 - 490
GRFTKETTQKNFNNLYGTKGNYTSRVWEYSSSIQNSDNDLPVVQGSSSFSLKGYPSLMRSQSPKAQPQTW    491 - 560
KSGKQTMLSHYRPFYVNKGNGIGSNEAP                                              561 - 588
//

Text Mined References (54)

PMID Year Title
26471361 2015 ATDC/TRIM29 Drives Invasive Bladder Cancer Formation through miRNA-Mediated and Epigenetic Mechanisms.
26381412 2015 ATDC (Ataxia Telangiectasia Group D Complementing) Promotes Radioresistance through an Interaction with the RNF8 Ubiquitin Ligase.
26191199 2015 TRIM29 functions as an oncogene in gastric cancer and is regulated by miR-185.
26095369 2015 TRIM29 regulates the assembly of DNA repair proteins into damaged chromatin.
26071105 2015 TRIM29 regulates the p63-mediated pathway in cervical cancer cells.
25491629 2014 Down-regulating ATDC inhibits the proliferation of esophageal carcinoma cells.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
24950909 2014 TRIM29 suppresses TWIST1 and invasive breast cancer behavior.
24864129 2014 TRIM29 as a novel biomarker in pancreatic adenocarcinoma.
More...