Property Summary

NCBI Gene PubMed Count 48
PubMed Score 28.49
PubTator Score 32.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
breast carcinoma 1614 3.38986818355051E-19
Breast cancer 3099 4.22827917857787E-13
non-small cell lung cancer 2798 1.44433236273377E-11
posterior fossa group A ependymoma 1511 4.21616385381825E-9
pancreatic cancer 2300 9.68230006249638E-9
malignant mesothelioma 3163 1.0143442020271E-7
pituitary cancer 1972 7.08824125449156E-7
osteosarcoma 7933 3.5877892831914E-6
interstitial cystitis 2299 1.27744804605059E-4
ovarian cancer 8492 2.67425766719944E-4
medulloblastoma, large-cell 6234 2.89388723181294E-4
colon cancer 1475 5.43430530117785E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 9.78860177621314E-4
active Crohn's disease 918 0.00784308513485615
active ulcerative colitis 477 0.0243270719245606
esophageal adenocarcinoma 737 0.024904588145064
primary pancreatic ductal adenocarcinoma 1271 0.0313694413307551
spina bifida 1064 0.0412572915265152
Disease Target Count Z-score Confidence
Ataxia telangiectasia 32 4.157 2.1
Cancer 2346 3.066 1.5

Expression

  Differential Expression (18)

Synonym

Accession Q14134 Q96AA9 Q9BZY7
Symbols ATDC

Gene

PDB

2CSV  

  Ortholog (12)

Gene RIF (27)

PMID Text
26471361 Findings established a role for ATDC/TRIM29 as a robust pathogenic driver of bladder cancer development, identified downstream effector pathways, and implicated ATDC as a candidate biomarker and therapeutic target.
26381412 define a novel function for ATDC in the RNF8-mediated DNA damage response and implicate RNF8 binding as a key determinant of the radioprotective function of ATDC
26191199 Results suggest that TRIM29 functions as an oncogene in gastric cancer and is regulated by miR-185.
26095369 TRIM29 functions as a scaffold protein to assemble DNA repair proteins into chromatin followed by efficient activation of DNA damage response.
26071105 These findings suggest that TRIM29 regulates the p63-mediated pathway and the behavior of cervical cancer cells.
25491629 Down-regulation of ATDC inhibits the growth and proliferation of esophageal carcinoma cells.
24950909 TWIST1 inhibited TRIM29 promoter activity.
24864129 TRIM29 promotes tumor progression and may be a novel prognostic marker for pancreatic ductal adenocarcinoma.
24485335 TRIM29 may be useful marker for distinguishing prostate cancers from benign tissues
24469230 Ataxia-telangiectasia group D-associated gene (ATDC) mediates resistance to ionizing radiation.
More...

AA Sequence

MEAADASRSNGSSPEARDARSPSGPSGSLENGTKADGKDAKTTNGHGGEAAEGKSLGSALKPGEGRSALF      1 - 70
AGNEWRRPIIQFVESGDDKNSNYFSMDSMEGKRSPYAGLQLGAAKKPPVTFAEKGELRKSIFSESRKPTV     71 - 140
SIMEPGETRRNSYPRADTGLFSRSKSGSEEVLCDSCIGNKQKAVKSCLVCQASFCELHLKPHLEGAAFRD    141 - 210
HQLLEPIRDFEARKCPVHGKTMELFCQTDQTCICYLCMFQEHKNHSTVTVEEAKAEKETELSLQKEQLQL    211 - 280
KIIEIEDEAEKWQKEKDRIKSFTTNEKAILEQNFRDLVRDLEKQKEEVRAALEQREQDAVDQVKVIMDAL    281 - 350
DERAKVLHEDKQTREQLHSISDSVLFLQEFGALMSNYSLPPPLPTYHVLLEGEGLGQSLGNFKDDLLNVC    351 - 420
MRHVEKMCKADLSRNFIERNHMENGGDHRYVNNYTNSFGGEWSAPDTMKRYSMYLTPKGGVRTSYQPSSP    421 - 490
GRFTKETTQKNFNNLYGTKGNYTSRVWEYSSSIQNSDNDLPVVQGSSSFSLKGYPSLMRSQSPKAQPQTW    491 - 560
KSGKQTMLSHYRPFYVNKGNGIGSNEAP                                              561 - 588
//

Text Mined References (54)

PMID Year Title
26471361 2015 ATDC/TRIM29 Drives Invasive Bladder Cancer Formation through miRNA-Mediated and Epigenetic Mechanisms.
26381412 2015 ATDC (Ataxia Telangiectasia Group D Complementing) Promotes Radioresistance through an Interaction with the RNF8 Ubiquitin Ligase.
26191199 2015 TRIM29 functions as an oncogene in gastric cancer and is regulated by miR-185.
26095369 2015 TRIM29 regulates the assembly of DNA repair proteins into damaged chromatin.
26071105 2015 TRIM29 regulates the p63-mediated pathway in cervical cancer cells.
25491629 2014 Down-regulating ATDC inhibits the proliferation of esophageal carcinoma cells.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
24950909 2014 TRIM29 suppresses TWIST1 and invasive breast cancer behavior.
24864129 2014 TRIM29 as a novel biomarker in pancreatic adenocarcinoma.
More...