Property Summary

NCBI Gene PubMed Count 54
PubMed Score 31.32
PubTator Score 32.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
active Crohn's disease 1.217 7.8e-03
active ulcerative colitis 3.315 2.4e-02
Breast cancer -3.300 4.2e-13
breast carcinoma -1.800 3.4e-19
colon cancer 3.100 1.4e-02
ependymoma 1.900 1.3e-06
esophageal adenocarcinoma -3.100 2.5e-02
interstitial cystitis -2.400 3.4e-02
intraductal papillary-mucinous neoplasm ... 3.100 9.8e-04
malignant mesothelioma 2.900 1.0e-07
medulloblastoma, large-cell 1.200 2.9e-04
non-small cell lung cancer 3.658 1.4e-11
osteosarcoma 1.405 3.6e-06
ovarian cancer 1.500 2.7e-04
pancreatic cancer 3.700 9.7e-09
pancreatic ductal adenocarcinoma liver m... 1.419 2.6e-02
pituitary cancer -2.000 7.1e-07
spina bifida -1.997 4.1e-02

Gene RIF (33)

AA Sequence

MEAADASRSNGSSPEARDARSPSGPSGSLENGTKADGKDAKTTNGHGGEAAEGKSLGSALKPGEGRSALF      1 - 70
AGNEWRRPIIQFVESGDDKNSNYFSMDSMEGKRSPYAGLQLGAAKKPPVTFAEKGELRKSIFSESRKPTV     71 - 140
SIMEPGETRRNSYPRADTGLFSRSKSGSEEVLCDSCIGNKQKAVKSCLVCQASFCELHLKPHLEGAAFRD    141 - 210
HQLLEPIRDFEARKCPVHGKTMELFCQTDQTCICYLCMFQEHKNHSTVTVEEAKAEKETELSLQKEQLQL    211 - 280
KIIEIEDEAEKWQKEKDRIKSFTTNEKAILEQNFRDLVRDLEKQKEEVRAALEQREQDAVDQVKVIMDAL    281 - 350
DERAKVLHEDKQTREQLHSISDSVLFLQEFGALMSNYSLPPPLPTYHVLLEGEGLGQSLGNFKDDLLNVC    351 - 420
MRHVEKMCKADLSRNFIERNHMENGGDHRYVNNYTNSFGGEWSAPDTMKRYSMYLTPKGGVRTSYQPSSP    421 - 490
GRFTKETTQKNFNNLYGTKGNYTSRVWEYSSSIQNSDNDLPVVQGSSSFSLKGYPSLMRSQSPKAQPQTW    491 - 560
KSGKQTMLSHYRPFYVNKGNGIGSNEAP                                              561 - 588
//

Text Mined References (60)

PMID Year Title