Property Summary

NCBI Gene PubMed Count 14
PubMed Score 5.48
PubTator Score 14.02

Knowledge Summary

Patent

No data available

Expression

Gene RIF (6)

AA Sequence

MERYAGALEEVADGARQQERHYQLLSALQSLVKELPSSFQQRLSYTTLSDLALALLDGTVFEIVQGLLEI      1 - 70
QHLTEKSLYNQRLRLQNEHRVLRQALRQKHQEAQQACRPHNLPVLQAAQQRELEAVEHRIREEQRAMDQK     71 - 140
IVLELDRKVADQQSTLEKAGVAGFYVTTNPQELMLQMNLLELIRKLQQRGCWAGKAALGLGGPWQLPAAQ    141 - 210
CDQKGSPVPP                                                                211 - 220
//

Text Mined References (16)

PMID Year Title