Property Summary

NCBI Gene PubMed Count 92
PubMed Score 104.28
PubTator Score 113.35

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (7)

Disease Target Count P-value
non-small cell lung cancer 2798 1.09390335176344E-24
posterior fossa group A ependymoma 1511 1.3366609748875E-20
cystic fibrosis 1670 2.0464354711468E-7
malignant mesothelioma 3163 2.62555980381701E-7
atypical teratoid / rhabdoid tumor 4369 1.99315179500882E-6
lung cancer 4473 2.19179083793648E-5
medulloblastoma, large-cell 6234 7.4368826859821E-5
pancreatic cancer 2300 8.62000243177143E-5
interstitial cystitis 2299 9.28120997680284E-5
nasopharyngeal carcinoma 1056 1.10611439278567E-4
medulloblastoma 1524 1.90687976649611E-4
adult high grade glioma 2148 2.82431216175889E-4
lung adenocarcinoma 2714 4.14125982748084E-4
psoriasis 6685 7.06821246267868E-4
facioscapulohumeral dystrophy 286 0.00212566073610218
glioblastoma 5572 0.0119379362934893
ovarian cancer 8492 0.0181696402513699
primitive neuroectodermal tumor 3031 0.0203248893032847
acute myeloid leukemia 785 0.0265523687125971
osteosarcoma 7933 0.0277882518941725
Breast cancer 3099 0.0307765710540876
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.037961000045607
urothelial carcinoma 318 0.0386938027795942
esophageal adenocarcinoma 737 0.0416897695228292
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0432315240863238
pulmonary arterial hypertension 36 0.0447930564683464
mucosa-associated lymphoid tissue lymphoma 480 0.047273139450222
Disease Target Count Z-score Confidence
Cardiomyopathy 110 0.0 4.0
Disease Target Count Z-score Confidence
Ritter's disease 10 3.691 1.8
Disease Target Count
Cardiomyopathy, dilated 1BB 1

Expression

Synonym

Accession Q14126 Q4KKU6
Symbols HDGC
CDHF5

Gene

PANTHER Protein Class (2)

PDB

2YQG   5ERD   5J5J  

  Ortholog (10)

Gene RIF (59)

PMID Text
25855637 This structure reveals that the ectodomain of Dsg2 is flexible even in the calcium-bound state and, on average, is shorter than the type 1 cadherin crystal structures.
25785582 a novel pathway of CSTA regulation involving Dsg2
25631074 Cellular biotinylated desmoglein 2 (DSG2) protein is incorporated into HIV-1 Gag virus-like particles
25468811 DSG2 and DSG3 might be potential diagnostic markers for squamous cell carcinoma of the lung.
25398255 Currently, 13 genes have been associated with the disease but nearly 40 % of clinically diagnosed cases remain without a genetic diagnosis.
25237006 In endometrial luminal epithelium, cadherin 6, desmoglein 2 and plexin b2 were surprisingly found in the apical as well as the lateral membrane domain; their knock-down compromised epithelial integrity.
25087486 Six variants of uncertain clinical significance in the PKP2, JUP, and DSG2 genes showed a deleterious effect on mRNA splicing, indicating these are ARVD/C-related pathogenic splice site mutations.
24896103 a low DSG2 expression phenotype is a useful prognostic biomarker of tumor aggressiveness and may serve as an aid in identifying patients with clinically significant prostate cancer.
24567334 Gal3 has a role in stabilizing desmoglein-2, a desmosomal cadherin, and intercellular adhesion in intestinal epithelial cells
24558503 Desmoglein 2 expression attenuates migration of melanoma cells, mediated by downregulation of secretogranin II.
More...

AA Sequence

MARSPGRAYALLLLLICFNVGSGLHLQVLSTRNENKLLPKHPHLVRQKRAWITAPVALREGEDLSKKNPI      1 - 70
AKIHSDLAEERGLKITYKYTGKGITEPPFGIFVFNKDTGELNVTSILDREETPFFLLTGYALDARGNNVE     71 - 140
KPLELRIKVLDINDNEPVFTQDVFVGSVEELSAAHTLVMKINATDADEPNTLNSKISYRIVSLEPAYPPV    141 - 210
FYLNKDTGEIYTTSVTLDREEHSSYTLTVEARDGNGEVTDKPVKQAQVQIRILDVNDNIPVVENKVLEGM    211 - 280
VEENQVNVEVTRIKVFDADEIGSDNWLANFTFASGNEGGYFHIETDAQTNEGIVTLIKEVDYEEMKNLDF    281 - 350
SVIVANKAAFHKSIRSKYKPTPIPIKVKVKNVKEGIHFKSSVISIYVSESMDRSSKGQIIGNFQAFDEDT    351 - 420
GLPAHARYVKLEDRDNWISVDSVTSEIKLAKLPDFESRYVQNGTYTVKIVAISEDYPRKTITGTVLINVE    421 - 490
DINDNCPTLIEPVQTICHDAEYVNVTAEDLDGHPNSGPFSFSVIDKPPGMAEKWKIARQESTSVLLQQSE    491 - 560
KKLGRSEIQFLISDNQGFSCPEKQVLTLTVCECLHGSGCREAQHDSYVGLGPAAIALMILAFLLLLLVPL    561 - 630
LLLMCHCGKGAKGFTPIPGTIEMLHPWNNEGAPPEDKVVPSFLPVDQGGSLVGRNGVGGMAKEATMKGSS    631 - 700
SASIVKGQHEMSEMDGRWEEHRSLLSGRATQFTGATGAIMTTETTKTARATGASRDMAGAQAAAVALNEE    701 - 770
FLRNYFTDKAASYTEEDENHTAKDCLLVYSQEETESLNASIGCCSFIEGELDDRFLDDLGLKFKTLAEVC    771 - 840
LGQKIDINKEIEQRQKPATETSMNTASHSLCEQTMVNSENTYSSGSSFPVPKSLQEANAEKVTQEIVTER    841 - 910
SVSSRQAQKVATPLPDPMASRNVIATETSYVTGSTMPPTTVILGPSQPQSLIVTERVYAPASTLVDQPYA    911 - 980
NEGTVVVTERVIQPHGGGSNPLEGTQHLQDVPYVMVRERESFLAPSSGVQPTLAMPNIAVGQNVTVTERV    981 - 1050
LAPASTLQSSYQIPTENSMTARNTTVSGAGVPGPLPDFGLEESGHSNSTITTSSTRVTKHSTVQHSYS     1051 - 1118
//

Text Mined References (103)

PMID Year Title
26469831 2015 Desmogleins as prognostic biomarkers in resected pancreatic ductal adenocarcinoma.
26296472 2015 Mutations of desmoglein-2 in sudden death from arrhythmogenic right ventricular cardiomyopathy and sudden unexplained death.
26292319 2015 Intracellular Signaling and Desmoglein 2 Shedding Triggered by Human Adenoviruses Ad3, Ad14, and Ad14P1.
26224314 2015 Inflammation-induced desmoglein-2 ectodomain shedding compromises the mucosal barrier.
26115074 2015 Loss of Desmoglein 2 Contributes to the Pathogenesis of Crohn's Disease.
26085008 2015 Desmoglein 2-Dependent Arrhythmogenic Cardiomyopathy Is Caused by a Loss of Adhesive Function.
25855637 2015 Cadherin flexibility provides a key difference between desmosomes and adherens junctions.
25785582 2015 Cell cycle- and cancer-associated gene networks activated by Dsg2: evidence of cystatin A deregulation and a potential role in cell-cell adhesion.
25660657 2015 Arrhythmogenic right ventricular cardiomyopathy with left ventricular involvement: a novel splice site mutation in the DSG2 gene.
25468811 2015 Expression of desmogleins 1-3 and their clinical impacts on human lung cancer.
More...