Property Summary

NCBI Gene PubMed Count 100
PubMed Score 117.74
PubTator Score 113.35

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Immune system cancer 140 0.0 0.5
Lymphoid leukemia 160 0.0 0.5
Disease Target Count Z-score Confidence
Cardiomyopathy 116 0.0 4.0
Disease Target Count Z-score Confidence
Pemphigus 23 4.291 2.1
Ritter's disease 10 3.629 1.8

Expression

  Differential Expression (27)

Disease log2 FC p
acute myeloid leukemia -2.800 2.7e-02
adult high grade glioma 1.700 2.8e-04
atypical teratoid / rhabdoid tumor 3.500 1.9e-04
Breast cancer 2.700 3.1e-02
cystic fibrosis 3.812 9.0e-08
ependymoma 2.800 2.0e-09
esophageal adenocarcinoma 1.900 4.2e-02
facioscapulohumeral dystrophy 2.400 2.1e-03
glioblastoma 1.500 1.8e-03
group 3 medulloblastoma 1.700 1.1e-02
interstitial cystitis -3.000 2.3e-02
intraductal papillary-mucinous carcinoma... 1.400 3.8e-02
intraductal papillary-mucinous neoplasm ... 1.800 4.3e-02
lung adenocarcinoma 1.341 4.1e-04
lung cancer 2.300 5.0e-05
malignant mesothelioma -1.700 2.6e-07
medulloblastoma, large-cell 3.300 5.1e-05
mucosa-associated lymphoid tissue lympho... -1.040 4.7e-02
nasopharyngeal carcinoma 1.600 1.1e-04
non-small cell lung cancer 2.805 1.1e-24
osteosarcoma -2.518 2.8e-02
ovarian cancer -1.200 1.6e-03
pancreatic cancer 1.100 7.6e-04
primitive neuroectodermal tumor 1.500 3.5e-02
psoriasis -1.700 1.0e-09
pulmonary arterial hypertension -1.700 4.5e-02
urothelial carcinoma -1.300 3.9e-02

Gene RIF (67)

AA Sequence

MARSPGRAYALLLLLICFNVGSGLHLQVLSTRNENKLLPKHPHLVRQKRAWITAPVALREGEDLSKKNPI      1 - 70
AKIHSDLAEERGLKITYKYTGKGITEPPFGIFVFNKDTGELNVTSILDREETPFFLLTGYALDARGNNVE     71 - 140
KPLELRIKVLDINDNEPVFTQDVFVGSVEELSAAHTLVMKINATDADEPNTLNSKISYRIVSLEPAYPPV    141 - 210
FYLNKDTGEIYTTSVTLDREEHSSYTLTVEARDGNGEVTDKPVKQAQVQIRILDVNDNIPVVENKVLEGM    211 - 280
VEENQVNVEVTRIKVFDADEIGSDNWLANFTFASGNEGGYFHIETDAQTNEGIVTLIKEVDYEEMKNLDF    281 - 350
SVIVANKAAFHKSIRSKYKPTPIPIKVKVKNVKEGIHFKSSVISIYVSESMDRSSKGQIIGNFQAFDEDT    351 - 420
GLPAHARYVKLEDRDNWISVDSVTSEIKLAKLPDFESRYVQNGTYTVKIVAISEDYPRKTITGTVLINVE    421 - 490
DINDNCPTLIEPVQTICHDAEYVNVTAEDLDGHPNSGPFSFSVIDKPPGMAEKWKIARQESTSVLLQQSE    491 - 560
KKLGRSEIQFLISDNQGFSCPEKQVLTLTVCECLHGSGCREAQHDSYVGLGPAAIALMILAFLLLLLVPL    561 - 630
LLLMCHCGKGAKGFTPIPGTIEMLHPWNNEGAPPEDKVVPSFLPVDQGGSLVGRNGVGGMAKEATMKGSS    631 - 700
SASIVKGQHEMSEMDGRWEEHRSLLSGRATQFTGATGAIMTTETTKTARATGASRDMAGAQAAAVALNEE    701 - 770
FLRNYFTDKAASYTEEDENHTAKDCLLVYSQEETESLNASIGCCSFIEGELDDRFLDDLGLKFKTLAEVC    771 - 840
LGQKIDINKEIEQRQKPATETSMNTASHSLCEQTMVNSENTYSSGSSFPVPKSLQEANAEKVTQEIVTER    841 - 910
SVSSRQAQKVATPLPDPMASRNVIATETSYVTGSTMPPTTVILGPSQPQSLIVTERVYAPASTLVDQPYA    911 - 980
NEGTVVVTERVIQPHGGGSNPLEGTQHLQDVPYVMVRERESFLAPSSGVQPTLAMPNIAVGQNVTVTERV    981 - 1050
LAPASTLQSSYQIPTENSMTARNTTVSGAGVPGPLPDFGLEESGHSNSTITTSSTRVTKHSTVQHSYS     1051 - 1118
//

Text Mined References (111)

PMID Year Title