Property Summary

NCBI Gene PubMed Count 92
Grant Count 27
R01 Count 16
Funding $1,812,417.32
PubMed Score 104.28
PubTator Score 113.35

Knowledge Summary

Patent

No data available

Expression

Gene RIF (59)

PMID Text
25855637 This structure reveals that the ectodomain of Dsg2 is flexible even in the calcium-bound state and, on average, is shorter than the type 1 cadherin crystal structures.
25785582 a novel pathway of CSTA regulation involving Dsg2
25631074 Cellular biotinylated desmoglein 2 (DSG2) protein is incorporated into HIV-1 Gag virus-like particles
25468811 DSG2 and DSG3 might be potential diagnostic markers for squamous cell carcinoma of the lung.
25398255 Currently, 13 genes have been associated with the disease but nearly 40 % of clinically diagnosed cases remain without a genetic diagnosis.
25237006 In endometrial luminal epithelium, cadherin 6, desmoglein 2 and plexin b2 were surprisingly found in the apical as well as the lateral membrane domain; their knock-down compromised epithelial integrity.
25087486 Six variants of uncertain clinical significance in the PKP2, JUP, and DSG2 genes showed a deleterious effect on mRNA splicing, indicating these are ARVD/C-related pathogenic splice site mutations.
24896103 a low DSG2 expression phenotype is a useful prognostic biomarker of tumor aggressiveness and may serve as an aid in identifying patients with clinically significant prostate cancer.
24567334 Gal3 has a role in stabilizing desmoglein-2, a desmosomal cadherin, and intercellular adhesion in intestinal epithelial cells
24558503 Desmoglein 2 expression attenuates migration of melanoma cells, mediated by downregulation of secretogranin II.
More...

AA Sequence

MARSPGRAYALLLLLICFNVGSGLHLQVLSTRNENKLLPKHPHLVRQKRAWITAPVALREGEDLSKKNPI      1 - 70
AKIHSDLAEERGLKITYKYTGKGITEPPFGIFVFNKDTGELNVTSILDREETPFFLLTGYALDARGNNVE     71 - 140
KPLELRIKVLDINDNEPVFTQDVFVGSVEELSAAHTLVMKINATDADEPNTLNSKISYRIVSLEPAYPPV    141 - 210
FYLNKDTGEIYTTSVTLDREEHSSYTLTVEARDGNGEVTDKPVKQAQVQIRILDVNDNIPVVENKVLEGM    211 - 280
VEENQVNVEVTRIKVFDADEIGSDNWLANFTFASGNEGGYFHIETDAQTNEGIVTLIKEVDYEEMKNLDF    281 - 350
SVIVANKAAFHKSIRSKYKPTPIPIKVKVKNVKEGIHFKSSVISIYVSESMDRSSKGQIIGNFQAFDEDT    351 - 420
GLPAHARYVKLEDRDNWISVDSVTSEIKLAKLPDFESRYVQNGTYTVKIVAISEDYPRKTITGTVLINVE    421 - 490
DINDNCPTLIEPVQTICHDAEYVNVTAEDLDGHPNSGPFSFSVIDKPPGMAEKWKIARQESTSVLLQQSE    491 - 560
KKLGRSEIQFLISDNQGFSCPEKQVLTLTVCECLHGSGCREAQHDSYVGLGPAAIALMILAFLLLLLVPL    561 - 630
LLLMCHCGKGAKGFTPIPGTIEMLHPWNNEGAPPEDKVVPSFLPVDQGGSLVGRNGVGGMAKEATMKGSS    631 - 700
SASIVKGQHEMSEMDGRWEEHRSLLSGRATQFTGATGAIMTTETTKTARATGASRDMAGAQAAAVALNEE    701 - 770
FLRNYFTDKAASYTEEDENHTAKDCLLVYSQEETESLNASIGCCSFIEGELDDRFLDDLGLKFKTLAEVC    771 - 840
LGQKIDINKEIEQRQKPATETSMNTASHSLCEQTMVNSENTYSSGSSFPVPKSLQEANAEKVTQEIVTER    841 - 910
SVSSRQAQKVATPLPDPMASRNVIATETSYVTGSTMPPTTVILGPSQPQSLIVTERVYAPASTLVDQPYA    911 - 980
NEGTVVVTERVIQPHGGGSNPLEGTQHLQDVPYVMVRERESFLAPSSGVQPTLAMPNIAVGQNVTVTERV    981 - 1050
LAPASTLQSSYQIPTENSMTARNTTVSGAGVPGPLPDFGLEESGHSNSTITTSSTRVTKHSTVQHSYS     1051 - 1118
//

Text Mined References (103)

PMID Year Title
26469831 2015 Desmogleins as prognostic biomarkers in resected pancreatic ductal adenocarcinoma.
26296472 2015 Mutations of desmoglein-2 in sudden death from arrhythmogenic right ventricular cardiomyopathy and sudden unexplained death.
26292319 2015 Intracellular Signaling and Desmoglein 2 Shedding Triggered by Human Adenoviruses Ad3, Ad14, and Ad14P1.
26224314 2015 Inflammation-induced desmoglein-2 ectodomain shedding compromises the mucosal barrier.
26115074 2015 Loss of Desmoglein 2 Contributes to the Pathogenesis of Crohn's Disease.
26085008 2015 Desmoglein 2-Dependent Arrhythmogenic Cardiomyopathy Is Caused by a Loss of Adhesive Function.
25855637 2015 Cadherin flexibility provides a key difference between desmosomes and adherens junctions.
25785582 2015 Cell cycle- and cancer-associated gene networks activated by Dsg2: evidence of cystatin A deregulation and a potential role in cell-cell adhesion.
25660657 2015 Arrhythmogenic right ventricular cardiomyopathy with left ventricular involvement: a novel splice site mutation in the DSG2 gene.
25468811 2015 Expression of desmogleins 1-3 and their clinical impacts on human lung cancer.
More...