Property Summary

NCBI Gene PubMed Count 21
PubMed Score 23.73
PubTator Score 21.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (6)

Disease Target Count
Substance-Related Disorders 114
Disease Target Count P-value
Breast cancer 3099 2.45560477065578E-51
non-small cell lung carcinoma 413 7.91231533283678E-30
breast carcinoma 1614 3.76286846625675E-27
lung adenocarcinoma 2714 8.85500871702247E-15
atypical teratoid / rhabdoid tumor 4369 1.58793129629081E-6
cystic fibrosis 1670 9.55425609008155E-6
group 4 medulloblastoma 1875 2.66718581595031E-5
malignant mesothelioma 3163 4.12963904582938E-5
medulloblastoma, large-cell 6234 2.55809129840006E-4
primitive neuroectodermal tumor 3031 4.14376465404471E-4
pediatric high grade glioma 2712 6.64356793251664E-4
astrocytic glioma 2241 0.00347900376175328
glioblastoma 5572 0.00376765734004551
progressive supranuclear palsy 674 0.00703321049944569
oligodendroglioma 2849 0.0100079310651196
ependymoma 2514 0.0103490168250905
interstitial cystitis 2299 0.0134106285008286
ductal carcinoma in situ 1745 0.0153844275187595
invasive ductal carcinoma 2950 0.0202127957283907
osteosarcoma 7933 0.0225055780034828
Pick disease 1893 0.0321203323163935
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Tracheal stenosis 18 3.103 1.6
Impotence 45 3.075 1.5

Expression

  Differential Expression (21)

Disease log2 FC p
malignant mesothelioma 1.500 0.000
astrocytic glioma -2.800 0.003
ependymoma -2.600 0.010
oligodendroglioma -2.500 0.010
glioblastoma -1.900 0.004
osteosarcoma -1.867 0.023
cystic fibrosis -1.775 0.000
atypical teratoid / rhabdoid tumor -3.200 0.000
medulloblastoma, large-cell -2.700 0.000
primitive neuroectodermal tumor -2.900 0.000
interstitial cystitis 1.100 0.013
lung adenocarcinoma -1.500 0.000
pediatric high grade glioma -1.800 0.001
group 4 medulloblastoma 1.700 0.000
non-small cell lung carcinoma -1.600 0.000
breast carcinoma -1.400 0.000
Pick disease -1.300 0.032
progressive supranuclear palsy -1.400 0.007
Breast cancer -2.900 0.000
ductal carcinoma in situ -1.200 0.015
invasive ductal carcinoma -1.500 0.020

Synonym

Accession Q14123 B3KPC6 E9PE92 Q14124 Q8NB10 Cam-PDE 1C
Symbols Hcam3
hCam-3
cam-PDE 1C

Gene

PANTHER Protein Class (2)

PDB

1LXS  

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG
Rat OMA EggNOG
Dog OMA EggNOG
Cow OMA EggNOG
Opossum OMA EggNOG

Gene RIF (8)

PMID Text
25620587 PDE1C is a proliferation-associated gene in glioblastoma multiforme cells in vitro.
25608528 PDE1C is an important regulator of SMC proliferation, migration, and neointimal hyperplasia, in part through modulating endosome/lysosome-dependent PDGFRbeta protein degradation via low-density lipoprotein receptor-related protein-1.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20110084 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)
17726023 PDE1C1 is expressed at high levels in human cardiac myocytes with an intracellular distribution distinct from that of PDE3A
16455054 PDE1C levels decreased in all conditions that inhibited proliferation
11156964 HIV-1 Tat decreases the intracellular levels of cAMP and CREB ser-133 phosphorylation through a signal transduction pathway involving sequential activation of phosphatidylinositol 3-kinase, AKT, and cyclic nucleoside phosphodiesterases

AA Sequence

MESPTKEIEEFESNSLKYLQPEQIEKIWLRLRGLRKYKKTSQRLRSLVKQLERGEASVVDLKKNLEYAAT      1 - 70
VLESVYIDETRRLLDTEDELSDIQSDAVPSEVRDWLASTFTRQMGMMLRRSDEKPRFKSIVHAVQAGIFV     71 - 140
ERMYRRTSNMVGLSYPPAVIEALKDVDKWSFDVFSLNEASGDHALKFIFYELLTRYDLISRFKIPISALV    141 - 210
SFVEALEVGYSKHKNPYHNLMHAADVTQTVHYLLYKTGVANWLTELEIFAIIFSAAIHDYEHTGTTNNFH    211 - 280
IQTRSDPAILYNDRSVLENHHLSAAYRLLQDDEEMNILINLSKDDWREFRTLVIEMVMATDMSCHFQQIK    281 - 350
AMKTALQQPEAIEKPKALSLMLHTADISHPAKAWDLHHRWTMSLLEEFFRQGDREAELGLPFSPLCDRKS    351 - 420
TMVAQSQVGFIDFIVEPTFTVLTDMTEKIVSPLIDETSQTGGTGQRRSSLNSISSSDAKRSGVKTSGSEG    421 - 490
SAPINNSVISVDYKSFKATWTEVVHINRERWRAKVPKEEKAKKEAEEKARLAAEEQQKEMEAKSQAEEGA    491 - 560
SGKAEKKTSGETKNQVNGTRANKSDNPRGKNSKAEKSSGEQQQNGDFKDGKNKTDKKDHSNIGNDSKKTD    561 - 630
GTKQRSHGSPAPSTSSTCRLTLPVIKPPLRHFKRPAYASSSYAPSVSKKTDEHPARYKMLDQRIKMKKIQ    631 - 700
NISHNWNRK                                                                 701 - 709
//

Text Mined References (22)

PMID Year Title
25620587 2016 Cyclic nucleotide phosphodiesterase-1C (PDE1C) drives cell proliferation, migration and invasion in glioblastoma multiforme cells in vitro.
25608528 2015 Role of cAMP-phosphodiesterase 1C signaling in regulating growth factor receptor stability, vascular smooth muscle cell growth, migration, and neointimal hyperplasia.
23509613 2013 Genome-wide association study of antiphospholipid antibodies.
23472165 2013 Genome-wide association study link novel loci to endometriosis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20110084 2010 Failure to replicate genetic associations with antidepressant treatment response in duloxetine-treated patients.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
18335582 2008 Kinetic properties of Ca2+/calmodulin-dependent phosphodiesterase isoforms dictate intracellular cAMP dynamics in response to elevation of cytosolic Ca2+.
17726023 2007 Cyclic nucleotide phosphodiesterase PDE1C1 in human cardiac myocytes.
More...