Property Summary

NCBI Gene PubMed Count 6
Grant Count 100
R01 Count 35
Funding $18,356,218.4
PubMed Score 100.38
PubTator Score 92.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
posterior fossa group B ependymoma 2.100 0.000
oligodendroglioma 1.700 0.017
psoriasis -2.400 0.000
astrocytoma 1.100 0.000
glioblastoma 1.700 0.000
group 3 medulloblastoma 2.500 0.000
atypical teratoid / rhabdoid tumor 1.400 0.000
medulloblastoma, large-cell 2.000 0.000
primitive neuroectodermal tumor 2.200 0.000
pediatric high grade glioma 1.600 0.000
pilocytic astrocytoma 1.400 0.000
ovarian cancer -1.400 0.000
Down syndrome 1.500 0.000

Synonym

Accession Q14119
Symbols DB1
ZNF161

Gene

Gene RIF (1)

PMID Text
22308494 find examples of genes in which Vezf1 binding sites are located near cassette exons, and in which loss of Vezf1 leads to a change in the relative abundance of alternatively spliced messages

AA Sequence

MEANWTAFLFQAHEASHHQQQAAQNSLLPLLSSAVEPPDQKPLLPIPITQKPQGAPETLKDAIGIKKEKP      1 - 70
KTSFVCTYCSKAFRDSYHLRRHESCHTGIKLVSRPKKTPTTVVPLISTIAGDSSRTSLVSTIAGILSTVT     71 - 140
TSSSGTNPSSSASTTAMPVTQSVKKPSKPVKKNHACEMCGKAFRDVYHLNRHKLSHSDEKPFECPICNQR    141 - 210
FKRKDRMTYHVRSHEGGITKPYTCSVCGKGFSRPDHLSCHVKHVHSTERPFKCQTCTAAFATKDRLRTHM    211 - 280
VRHEGKVSCNICGKLLSAAYITSHLKTHGQSQSINCNTCKQGISKTCMSEETSNQKQQQQQQQQQQQQQQ    281 - 350
QQQQHVTSWPGKQVETLRLWEEAVKARKKEAANLCQTSTAATTPVTLTTPFSITSSVSSGTMSNPVTVAA    351 - 420
AMSMRSPVNVSSAVNITSPMNIGHPVTITSPLSMTSPLTLTTPVNLPTPVTAPVNIAHPVTITSPMNLPT    421 - 490
PMTLAAPLNIAMRPVESMPFLPQALPTSPPW                                           491 - 521
//

Text Mined References (10)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22308494 2012 Vezf1 protein binding sites genome-wide are associated with pausing of elongating RNA polymerase II.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
11504723 2001 Vezf1/DB1 is an endothelial cell-specific transcription factor that regulates expression of the endothelin-1 promoter.
9865462 1998 Functional interaction between RhoB and the transcription factor DB1.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8035792 1994 Molecular cloning of a novel human cDNA encoding a zinc finger protein that binds to the interleukin-3 promoter.