Property Summary

NCBI Gene PubMed Count 6
PubMed Score 107.36
PubTator Score 92.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma 1.300 1.4e-03
astrocytoma 1.100 3.2e-18
Astrocytoma, Pilocytic 1.400 1.0e-06
atypical teratoid / rhabdoid tumor 1.400 8.6e-06
Down syndrome 1.500 2.1e-04
ependymoma 1.800 2.0e-02
glioblastoma 1.700 4.4e-10
group 3 medulloblastoma 2.500 1.6e-05
medulloblastoma, large-cell 2.000 5.0e-05
oligodendroglioma 1.700 1.7e-02
ovarian cancer -1.400 1.7e-04
primitive neuroectodermal tumor 2.200 2.9e-06
psoriasis -1.200 4.9e-09

Gene RIF (1)

AA Sequence

MEANWTAFLFQAHEASHHQQQAAQNSLLPLLSSAVEPPDQKPLLPIPITQKPQGAPETLKDAIGIKKEKP      1 - 70
KTSFVCTYCSKAFRDSYHLRRHESCHTGIKLVSRPKKTPTTVVPLISTIAGDSSRTSLVSTIAGILSTVT     71 - 140
TSSSGTNPSSSASTTAMPVTQSVKKPSKPVKKNHACEMCGKAFRDVYHLNRHKLSHSDEKPFECPICNQR    141 - 210
FKRKDRMTYHVRSHEGGITKPYTCSVCGKGFSRPDHLSCHVKHVHSTERPFKCQTCTAAFATKDRLRTHM    211 - 280
VRHEGKVSCNICGKLLSAAYITSHLKTHGQSQSINCNTCKQGISKTCMSEETSNQKQQQQQQQQQQQQQQ    281 - 350
QQQQHVTSWPGKQVETLRLWEEAVKARKKEAANLCQTSTAATTPVTLTTPFSITSSVSSGTMSNPVTVAA    351 - 420
AMSMRSPVNVSSAVNITSPMNIGHPVTITSPLSMTSPLTLTTPVNLPTPVTAPVNIAHPVTITSPMNLPT    421 - 490
PMTLAAPLNIAMRPVESMPFLPQALPTSPPW                                           491 - 521
//

Text Mined References (10)

PMID Year Title