Property Summary

NCBI Gene PubMed Count 117
PubMed Score 559.96
PubTator Score 86.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count P-value
psoriasis 6694 1.1e-05
lung cancer 4740 2.8e-04
atypical teratoid / rhabdoid tumor 5112 4.4e-04
astrocytoma 1146 1.2e-03
ovarian cancer 8520 5.4e-03
oligodendroglioma 2850 1.1e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.7
Disease Target Count Z-score Confidence
Crohn's disease 321 0.0 1.6
Disease Target Count Z-score Confidence
Lissencephaly 69 4.629 2.3
limb-girdle muscular dystrophy 37 0.0 4.0
Disease Target Count Z-score Confidence
Myopathy 185 6.737 3.4
Cardiomyopathy 116 3.249 1.6

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytoma 2.200 1.2e-03
atypical teratoid / rhabdoid tumor 1.200 4.4e-04
lung cancer 1.300 2.8e-04
oligodendroglioma 1.300 1.1e-02
ovarian cancer 1.400 5.4e-03
psoriasis -2.600 1.1e-05

Gene RIF (65)

AA Sequence

MRMSVGLSLLLPLSGRTFLLLLSVVMAQSHWPSEPSEAVRDWENQLEASMHSVLSDLHEAVPTVVGIPDG      1 - 70
TAVVGRSFRVTIPTDLIASSGDIIKVSAAGKEALPSWLHWDSQSHTLEGLPLDTDKGVHYISVSATRLGA     71 - 140
NGSHIPQTSSVFSIEVYPEDHSELQSVRTASPDPGEVVSSACAADEPVTVLTVILDADLTKMTPKQRIDL    141 - 210
LHRMRSFSEVELHNMKLVPVVNNRLFDMSAFMAGPGNAKKVVENGALLSWKLGCSLNQNSVPDIHGVEAP    211 - 280
AREGAMSAQLGYPVVGWHIANKKPPLPKRVRRQIHATPTPVTAIGPPTTAIQEPPSRIVPTPTSPAIAPP    281 - 350
TETMAPPVRDPVPGKPTVTIRTRGAIIQTPTLGPIQPTRVSEAGTTVPGQIRPTMTIPGYVEPTAVATPP    351 - 420
TTTTKKPRVSTPKPATPSTDSTTTTTRRPTKKPRTPRPVPRVTTKVSITRLETASPPTRIRTTTSGVPRG    421 - 490
GEPNQRPELKNHIDRVDAWVGTYFEVKIPSDTFYDHEDTTTDKLKLTLKLREQQLVGEKSWVQFNSNSQL    491 - 560
MYGLPDSSHVGKHEYFMHATDKGGLSAVDAFEIHVHRRPQGDRAPARFKAKFVGDPALVLNDIHKKIALV    561 - 630
KKLAFAFGDRNCSTITLQNITRGSIVVEWTNNTLPLEPCPKEQIAGLSRRIAEDDGKPRPAFSNALEPDF    631 - 700
KATSITVTGSGSCRHLQFIPVVPPRRVPSEAPPTEVPDRDPEKSSEDDVYLHTVIPAVVVAAILLIAGII    701 - 770
AMICYRKKRKGKLTLEDQATFIKKGVPIIFADELDDSKPPPSSSMPLILQEEKAPLPPPEYPNQSVPETT    771 - 840
PLNQDTMGEYTPLRDEDPNAPPYQPPPPFTAPMEGKGSRPKNMTPYRSPPPYVPP                   841 - 895
//

Text Mined References (134)

PMID Year Title