Property Summary

NCBI Gene PubMed Count 110
Grant Count 161
R01 Count 78
Funding $26,040,706.49
PubMed Score 528.46
PubTator Score 86.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
oligodendroglioma 1.300 0.011
psoriasis -2.600 0.000
astrocytoma 2.200 0.001
atypical teratoid / rhabdoid tumor 1.200 0.000
lung cancer 1.300 0.000
ovarian cancer 1.400 0.005

Synonym

Accession Q14118 A8K6M7 Q969J9
Symbols A3a
DAG
AGRNR
156DAG
MDDGA9
MDDGC7
MDDGC9

Gene

PANTHER Protein Class (1)

PDB

5GGP   1EG4   2MK7  

Gene RIF (60)

PMID Text
26077903 alpha-DG-N removal as an important posttranslational control of endometrial receptivity and uterine fluid alpha-DG-N as a potential biomarker for receptivity in women.
25503980 Novel mutations in DAG1 are associated with asymptomatic hyperCKemia with hypoglycosylation of alpha-dystroglycan.
25139094 Reduction of alpha-dystroglycan expression is correlated with glioma.
25082828 Phosphorylation within the cysteine-rich region of dystrophin enhances its association with beta-dystroglycan and identifies a potential novel therapeutic target for skeletal muscle wasting.
24792180 Depletion of DAG resulted in altered morphology and reduced properties of differentiated HL-60 cells, including chemotaxis, respiratory burst, phagocytic activities and markers of differentiation, implicating DAG as a protein involved in differentiation.
24361964 T192M point-mutation in dystroglycan leads to a weaker interactions with laminin-1, which leads to hypoglycosylation and which finally leads to the limb girdle disease.
24077328 These data suggest that proteolysis, tyrosine phosphorylation and translocation of dystroglycan to the nucleus resulting in altered gene transcription could be important mechanisms in the progression of prostate cancer.
24052401 A report of a homozygous novel DAG1 missense mutation c.2006G>T in the beta-subunit of dystroglycan in two Libyan siblings with with a novel muscle-eye-brain disease-like phenotype with multicystic leucodystrophy.
24041696 GTDC2 generates CTD110.6 antibody-reactive N-acetylglucosamine epitopes on the O-mannosylated alpha-dystroglycan.
23951345 The study provides evidence for at least three separate pools of dystroglycan complexes within myofibers that differ in composition and are differentially affected by loss of dystrophin.
More...

AA Sequence

MRMSVGLSLLLPLSGRTFLLLLSVVMAQSHWPSEPSEAVRDWENQLEASMHSVLSDLHEAVPTVVGIPDG      1 - 70
TAVVGRSFRVTIPTDLIASSGDIIKVSAAGKEALPSWLHWDSQSHTLEGLPLDTDKGVHYISVSATRLGA     71 - 140
NGSHIPQTSSVFSIEVYPEDHSELQSVRTASPDPGEVVSSACAADEPVTVLTVILDADLTKMTPKQRIDL    141 - 210
LHRMRSFSEVELHNMKLVPVVNNRLFDMSAFMAGPGNAKKVVENGALLSWKLGCSLNQNSVPDIHGVEAP    211 - 280
AREGAMSAQLGYPVVGWHIANKKPPLPKRVRRQIHATPTPVTAIGPPTTAIQEPPSRIVPTPTSPAIAPP    281 - 350
TETMAPPVRDPVPGKPTVTIRTRGAIIQTPTLGPIQPTRVSEAGTTVPGQIRPTMTIPGYVEPTAVATPP    351 - 420
TTTTKKPRVSTPKPATPSTDSTTTTTRRPTKKPRTPRPVPRVTTKVSITRLETASPPTRIRTTTSGVPRG    421 - 490
GEPNQRPELKNHIDRVDAWVGTYFEVKIPSDTFYDHEDTTTDKLKLTLKLREQQLVGEKSWVQFNSNSQL    491 - 560
MYGLPDSSHVGKHEYFMHATDKGGLSAVDAFEIHVHRRPQGDRAPARFKAKFVGDPALVLNDIHKKIALV    561 - 630
KKLAFAFGDRNCSTITLQNITRGSIVVEWTNNTLPLEPCPKEQIAGLSRRIAEDDGKPRPAFSNALEPDF    631 - 700
KATSITVTGSGSCRHLQFIPVVPPRRVPSEAPPTEVPDRDPEKSSEDDVYLHTVIPAVVVAAILLIAGII    701 - 770
AMICYRKKRKGKLTLEDQATFIKKGVPIIFADELDDSKPPPSSSMPLILQEEKAPLPPPEYPNQSVPETT    771 - 840
PLNQDTMGEYTPLRDEDPNAPPYQPPPPFTAPMEGKGSRPKNMTPYRSPPPYVPP                   841 - 895
//

Text Mined References (127)

PMID Year Title
26077903 2015 Posttranslational removal of ?-dystroglycan N terminus by PC5/6 cleavage is important for uterine preparation for embryo implantation in women.
25934851 2015 Absence of ?- and ?-dystroglycan is associated with Walker-Warburg syndrome.
25503980 2015 DAG1 mutations associated with asymptomatic hyperCKemia and hypoglycosylation of ?-dystroglycan.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
25139094 2014 Reduction of ?-dystroglycan expression is correlated with poor prognosis in glioma.
25082828 2014 Phosphorylation within the cysteine-rich region of dystrophin enhances its association with ?-dystroglycan and identifies a potential novel therapeutic target for skeletal muscle wasting.
24792180 2014 Dystroglycan depletion inhibits the functions of differentiated HL-60 cells.
24361964 2014 Hypoglycosylation of dystroglycan due to T192M mutation: a molecular insight behind the fact.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24256719 2013 AGO61-dependent GlcNAc modification primes the formation of functional glycans on ?-dystroglycan.
More...