Property Summary

NCBI Gene PubMed Count 17
PubMed Score 65.01
PubTator Score 214.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count P-value
ovarian cancer 8520 2.1e-11
adrenocortical carcinoma 1428 1.8e-04
adrenocortical adenoma 131 1.3e-03
nephrosclerosis 333 2.0e-02
chronic rhinosinusitis 512 2.6e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Disease Target Count
Dihydropyrimidinuria 1

Expression

  Differential Expression (5)

Disease log2 FC p
adrenocortical adenoma -1.483 1.3e-03
adrenocortical carcinoma -1.784 1.8e-04
chronic rhinosinusitis -1.655 2.6e-02
nephrosclerosis -2.282 2.0e-02
ovarian cancer -2.900 2.1e-11

Synonym

Accession Q14117 DHP
Symbols DHP
DHPase

Gene

PANTHER Protein Class (2)

PDB

2VR2  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (3)

Gene RIF (9)

AA Sequence

MAAPSRLLIRGGRVVNDDFSEVADVLVEDGVVRALGHDLLPPGGAPAGLRVLDAAGKLVLPGGIDTHTHM      1 - 70
QFPFMGSRSIDDFHQGTKAALSGGTTMIIDFAIPQKGGSLIEAFETWRSWADPKVCCDYSLHVAVTWWSD     71 - 140
QVKEEMKILVQDKGVNSFKMFMAYKDLYMVTDLELYEAFSRCKEIGAIAQVHAENGDLIAEGAKKMLALG    141 - 210
ITGPEGHELCRPEAVEAEATLRAITIASAVNCPLYIVHVMSKSAAKVIADARRDGKVVYGEPIAASLGTD    211 - 280
GTHYWNKEWHHAAHHVMGPPLRPDPSTPDFLMNLLANDDLTTTGTDNCTFNTCQKALGKDDFTKIPNGVN    281 - 350
GVEDRMSVIWEKGVHSGKMDENRFVAVTSTNAAKIFNLYPRKGRIAVGSDADIVIWDPKGTRTISAKTHH    351 - 420
QAVNFNIFEGMVCHGVPLVTISRGKVVYEAGVFSVTAGDGKFIPRKPFAEYIYKRIKQRDRTCTPTPVER    421 - 490
APYKGEVATLKSRVTKEDATAGTRKQAHP                                             491 - 519
//

Text Mined References (18)

PMID Year Title