Property Summary

NCBI Gene PubMed Count 880
PubMed Score 2531.95
PubTator Score 2177.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (18)

Disease log2 FC p
psoriasis -1.200 4.3e-03
adult high grade glioma 1.300 3.9e-03
Astrocytoma, Pilocytic 1.500 7.4e-06
esophageal adenocarcinoma -2.100 4.4e-02
gastric carcinoma 1.800 1.9e-02
head and neck cancer -1.500 1.3e-02
interstitial cystitis -1.900 8.2e-04
invasive ductal carcinoma 1.100 6.1e-03
lung cancer -1.900 2.7e-03
lung carcinoma -3.400 1.0e-30
malignant mesothelioma -7.900 5.2e-10
medulloblastoma, large-cell -1.200 1.3e-05
osteosarcoma -2.489 1.7e-03
ovarian cancer -3.600 5.9e-11
pancreatic cancer 1.500 9.5e-05
primary Sjogren syndrome 1.300 5.0e-03
spina bifida -1.713 4.2e-02
subependymal giant cell astrocytoma 2.258 8.9e-03

Synonym

Accession Q14116 O75599 Q6FGY3 Q6WWJ7 IL-18
Symbols IGIF
IL-18
IL-1g
IL1F4

Gene

PDB

3WO3   3WO4   4R6U   1J0S   2VXT   3F62   3WO2   4EEE   4EKX   4HJJ   4XFS   4XFT   4XFU  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Function (1)

 GWAS Trait (1)

Protein-protein Interaction (2)

Gene RIF (951)

AA Sequence

MAAEPVEDNCINFVAMKFIDNTLYFIAEDDENLESDYFGKLESKLSVIRNLNDQVLFIDQGNRPLFEDMT      1 - 70
DSDCRDNAPRTIFIISMYKDSQPRGMAVTISVKCEKISTLSCENKIISFKEMNPPDNIKDTKSDIIFFQR     71 - 140
SVPGHDNKMQFESSSYEGYFLACEKERDLFKLILKKEDELGDRSIMFTVQNED                     141 - 193
//

Text Mined References (883)

PMID Year Title