Property Summary

NCBI Gene PubMed Count 816
PubMed Score 2381.25
PubTator Score 2177.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
lung carcinoma 2844 1.01747685330521E-30
ovarian cancer 8492 5.89313783244484E-11
malignant mesothelioma 3163 5.20136742029178E-10
pilocytic astrocytoma 3086 7.88757357318529E-6
medulloblastoma, large-cell 6234 1.28752060211167E-5
lung cancer 4473 4.27671953010775E-5
pancreatic cancer 2300 9.53390475789178E-5
interstitial cystitis 2299 8.15702496139506E-4
osteosarcoma 7933 0.00169297942305178
adult high grade glioma 2148 0.00392064792745919
primary Sjogren syndrome 789 0.00502054396887265
invasive ductal carcinoma 2950 0.00610688738791086
subependymal giant cell astrocytoma 2287 0.00890811589283509
head and neck cancer 270 0.0126144434572178
gastric carcinoma 832 0.0188851761291034
spina bifida 1064 0.0420026951383252
esophageal adenocarcinoma 737 0.0435766363026859

Expression

  Differential Expression (18)

Disease log2 FC p
malignant mesothelioma -7.900 0.000
esophageal adenocarcinoma -2.100 0.044
psoriasis -1.200 0.004
osteosarcoma -2.489 0.002
medulloblastoma, large-cell -1.200 0.000
lung cancer -2.700 0.000
pancreatic cancer 1.500 0.000
interstitial cystitis -1.900 0.001
adult high grade glioma 1.300 0.004
pilocytic astrocytoma 1.500 0.000
primary Sjogren syndrome 1.300 0.005
subependymal giant cell astrocytoma 2.258 0.009
lung carcinoma -3.400 0.000
spina bifida -1.713 0.042
gastric carcinoma 1.800 0.019
invasive ductal carcinoma 1.100 0.006
ovarian cancer -3.600 0.000
head and neck cancer -1.500 0.013

Synonym

Accession Q14116 O75599 Q6FGY3 Q6WWJ7 IL-18
Symbols IGIF
IL-18
IL-1g
IL1F4

Gene

PDB

3WO3   3WO4   4R6U   1J0S   2VXT   3F62   3WO2   4EEE   4EKX   4HJJ   4XFS   4XFT   4XFU  

  Ortholog (10)

 GO Function (1)

 GWAS Trait (1)

Gene RIF (888)

PMID Text
27027876 These data suggest that genetic variation within the promoter region of IL18 is directly involved in the susceptibility to infection by Trypanosoma cruzi, which provides novel insight into disease pathophysiology.
26804591 we report on the first-time detection of in-situ expression of activated IL-18 in the human brain in sALS patients.
26743536 Correlation patterns of IL-18/anti-IL-18 auto-Abs system differed in healthy donors and multiple sclerosis patients
26728085 This study demonstrated that IL-18 is dysregulated in autism spectrum disorders patients.
26690141 Evidence-based understanding of the role of IL-18 in skin diseases and its relationship with disease activities. [review]
26683353 IL-18 is an important predictor of mortality in humans with both severe sepsis and septic shock, independent of IL-1beta
26681034 the -607 C/A polymorphism in the IL-18 gene may be associated with susceptibility to esophageal cancer.
26669254 IL-18 seems to be important indicator and predictor of cardiovascular death in two-year follow-up among non-diabetic patients suffering from CKD, with history of AMI in the previous year.
26600055 IL-18 and IL-18R polymorphisms may contribute to the development and lymph node metastasis of PTC.
26474654 IL-18 -137G/C polymorphism contributed to TB susceptibility in Chinese Han population.
More...

AA Sequence

MAAEPVEDNCINFVAMKFIDNTLYFIAEDDENLESDYFGKLESKLSVIRNLNDQVLFIDQGNRPLFEDMT      1 - 70
DSDCRDNAPRTIFIISMYKDSQPRGMAVTISVKCEKISTLSCENKIISFKEMNPPDNIKDTKSDIIFFQR     71 - 140
SVPGHDNKMQFESSSYEGYFLACEKERDLFKLILKKEDELGDRSIMFTVQNED                     141 - 193
//

Text Mined References (818)

PMID Year Title
27027876 2016 IL18 Gene Variants Influence the Susceptibility to Chagas Disease.
26804591 2016 In-situ expression of Interleukin-18 and associated mediators in the human brain of sALS patients: Hypothesis for a role for immune-inflammatory mechanisms.
26743536 2016 Use of the VH6-1 gene segment to code for anti-interleukin-18 autoantibodies in multiple sclerosis.
26728085 2016 Interleukin-18 modulation in autism spectrum disorders.
26690141 2015 IL-18 and Cutaneous Inflammatory Diseases.
26683353 2016 Biochemical and inflammatory aspects in patients with severe sepsis and septic shock: The predictive role of IL-18 in mortality.
26681034 2015 Association between the -607 C > A polymorphism in interleukin-18 gene promoter with gastrointestinal cancer risk: a meta-analysis.
26669254 2015 Usefulness of serum interleukin-18 in predicting cardiovascular mortality in patients with chronic kidney disease--systems and clinical approach.
26600055 2015 Single Nucleotide Polymorphism of Interleukin-18 and Interleukin-18 Receptor and the Risk of Papillary Thyroid Cancer.
26474654 2015 The -137G/C single nucleotide polymorphism in IL-18 gene promoter contributes to tuberculosis susceptibility in Chinese Han population.
More...