Property Summary

NCBI Gene PubMed Count 72
Grant Count 130
R01 Count 70
Funding $12,520,321.05
PubMed Score 141.66
PubTator Score 93.32

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q14114 B1AMT6 B1AMT7 B1AMT8 O14968 Q86V27 Q99876 Q9BR78 LRP-8
Symbols MCI1
LRP-8
APOER2
HSZ75190

Gene

PDB

3A7Q  

Gene RIF (48)

PMID Text
26817215 two SNPs (rs3737984 and rs2297660) in ApoER2 gene had significant association with dyslipidemia in Thai ethnic
26800564 ApoER2 contributes cooperatively with endothelial cell protein C receptor and protease activated receptor 1 to APC-initiated endothelial antiapoptotic and barrier protective signaling.
24867879 A novel TACGC risk haplotype in the LRP8 gene that is present in patients with CAD and MI but not in normal controls.
24844606 results of this study demonstrated the presence of reelin, its receptors VLDLR and ApoER2 as well as Dab1 in the ENS and might indicate a novel role of the reelin system in regulating neuronal plasticity and pre-synaptic functions in the ENS.
24344333 Data suggest that PS1/gamma-secretase-dependent processing of the reelin receptor ApoER2 inhibits reelin expression and may regulate its signaling.
24076391 ectopic expression of HIC1 in U2OS and MDA-MB-231 cell lines decreases expression of the ApoER2 and VLDLR genes, encoding two canonical tyrosine kinase receptors for Reelin.
23739027 By incorporating the information from bioinformatics and RNA expression analyses, we identified at least two of the most promising risk genes for alcohol dependence: APOER2 and UBAP2
23524007 TCCGC haplotype at the 3'-terminal block of the LRP8 gene confers a protective role in the development of familial and early-onset coronary artery disease and/or myocardial infarction.
22889673 In a Chinese unrelated Han population, variants within the LRP8 gene do not convey the risk of developing Parkinson's disease.
22589174 results identify LRP8 as a novel positive factor of canonical Wnt signaling pathway
More...

AA Sequence

MGLPEPGPLRLLALLLLLLLLLLLQLQHLAAAAADPLLGGQGPAKDCEKDQFQCRNERCIPSVWRCDEDD      1 - 70
DCLDHSDEDDCPKKTCADSDFTCDNGHCIHERWKCDGEEECPDGSDESEATCTKQVCPAEKLSCGPTSHK     71 - 140
CVPASWRCDGEKDCEGGADEAGCATLCAPHEFQCGNRSCLAAVFVCDGDDDCGDGSDERGCADPACGPRE    141 - 210
FRCGGDGGGACIPERWVCDRQFDCEDRSDEAAELCGRPGPGATSAPAACATASQFACRSGECVHLGWRCD    211 - 280
GDRDCKDKSDEADCPLGTCRGDEFQCGDGTCVLAIKHCNQEQDCPDGSDEAGCLQGLNECLHNNGGCSHI    281 - 350
CTDLKIGFECTCPAGFQLLDQKTCGDIDECKDPDACSQICVNYKGYFKCECYPGYEMDLLTKNCKAAAGK    351 - 420
SPSLIFTNRHEVRRIDLVKRNYSRLIPMLKNVVALDVEVATNRIYWCDLSYRKIYSAYMDKASDPKEQEV    421 - 490
LIDEQLHSPEGLAVDWVHKHIYWTDSGNKTISVATVDGGRRRTLFSRNLSEPRAIAVDPLRGFMYWSDWG    491 - 560
DQAKIEKSGLNGVDRQTLVSDNIEWPNGITLDLLSQRLYWVDSKLHQLSSIDFSGGNRKTLISSTDFLSH    561 - 630
PFGIAVFEDKVFWTDLENEAIFSANRLNGLEISILAENLNNPHDIVIFHELKQPRAPDACELSVQPNGGC    631 - 700
EYLCLPAPQISSHSPKYTCACPDTMWLGPDMKRCYRAPQSTSTTTLASTMTRTVPATTRAPGTTVHRSTY    701 - 770
QNHSTETPSLTAAVPSSVSVPRAPSISPSTLSPATSNHSQHYANEDSKMGSTVTAAVIGIIVPIVVIALL    771 - 840
CMSGYLIWRNWKRKNTKSMNFDNPVYRKTTEEEDEDELHIGRTAQIGHVYPAAISSFDRPLWAEPCLGET    841 - 910
REPEDPAPALKELFVLPGEPRSQLHQLPKNPLSELPVVKSKRVALSLEDDGLP                     911 - 963
//

Text Mined References (74)

PMID Year Title
26817215 2015 Apolipoprotein E receptor 2 Gene Polymorphisms Associated with Dyslipidemia among Thai Population.
26800564 2016 Apolipoprotein E Receptor 2 Mediates Activated Protein C-Induced Endothelial Akt Activation and Endothelial Barrier Stabilization.
24867879 2014 A novel molecular diagnostic marker for familial and early-onset coronary artery disease and myocardial infarction in the LRP8 gene.
24844606 2014 Expression and regulation of reelin and its receptors in the enteric nervous system.
24344333 2014 ApoER2 processing by presenilin-1 modulates reelin expression.
24076391 2013 The Reelin receptors ApoER2 and VLDLR are direct target genes of HIC1 (Hypermethylated In Cancer 1).
23739027 2013 Exome-wide association study of replicable nonsynonymous variants conferring risk for alcohol dependence.
23524007 2013 Multi-allelic haplotype association identifies novel information different from single-SNP analysis: a new protective haplotype in the LRP8 gene is against familial and early-onset CAD and MI.
23382219 2013 Structural basis for endosomal trafficking of diverse transmembrane cargos by PX-FERM proteins.
23192594 2013 Gene-environment interactions and obesity traits among postmenopausal African-American and Hispanic women in the Women's Health Initiative SHARe Study.
More...