Property Summary

NCBI Gene PubMed Count 79
PubMed Score 148.67
PubTator Score 93.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (25)

Disease log2 FC p
active Crohn's disease 1.783 2.3e-03
active ulcerative colitis 1.136 1.9e-02
adult high grade glioma -1.300 1.7e-04
Atopic dermatitis 1.100 3.8e-04
atypical teratoid / rhabdoid tumor -1.600 7.2e-04
Breast cancer 1.500 1.0e-05
colon cancer 1.800 3.8e-02
cutaneous lupus erythematosus 1.100 7.9e-03
ependymoma -1.200 1.1e-03
glioblastoma -1.100 1.0e-02
group 3 medulloblastoma 1.100 5.4e-03
intraductal papillary-mucinous carcinoma... 1.300 3.5e-02
intraductal papillary-mucinous neoplasm ... 1.800 3.4e-03
invasive ductal carcinoma 1.500 1.1e-02
lung adenocarcinoma 1.300 1.1e-08
lung cancer 3.000 1.0e-04
non-small cell lung cancer 1.411 3.8e-14
osteosarcoma -1.116 3.3e-02
ovarian cancer 1.600 2.3e-04
Pick disease 1.100 3.9e-05
pituitary cancer -1.100 1.8e-04
primary Sjogren syndrome 1.200 6.9e-03
psoriasis 1.600 2.7e-03
subependymal giant cell astrocytoma -1.411 1.1e-02
tuberculosis and treatment for 6 months 1.400 3.3e-04

Gene RIF (52)

AA Sequence

MGLPEPGPLRLLALLLLLLLLLLLQLQHLAAAAADPLLGGQGPAKDCEKDQFQCRNERCIPSVWRCDEDD      1 - 70
DCLDHSDEDDCPKKTCADSDFTCDNGHCIHERWKCDGEEECPDGSDESEATCTKQVCPAEKLSCGPTSHK     71 - 140
CVPASWRCDGEKDCEGGADEAGCATLCAPHEFQCGNRSCLAAVFVCDGDDDCGDGSDERGCADPACGPRE    141 - 210
FRCGGDGGGACIPERWVCDRQFDCEDRSDEAAELCGRPGPGATSAPAACATASQFACRSGECVHLGWRCD    211 - 280
GDRDCKDKSDEADCPLGTCRGDEFQCGDGTCVLAIKHCNQEQDCPDGSDEAGCLQGLNECLHNNGGCSHI    281 - 350
CTDLKIGFECTCPAGFQLLDQKTCGDIDECKDPDACSQICVNYKGYFKCECYPGYEMDLLTKNCKAAAGK    351 - 420
SPSLIFTNRHEVRRIDLVKRNYSRLIPMLKNVVALDVEVATNRIYWCDLSYRKIYSAYMDKASDPKEQEV    421 - 490
LIDEQLHSPEGLAVDWVHKHIYWTDSGNKTISVATVDGGRRRTLFSRNLSEPRAIAVDPLRGFMYWSDWG    491 - 560
DQAKIEKSGLNGVDRQTLVSDNIEWPNGITLDLLSQRLYWVDSKLHQLSSIDFSGGNRKTLISSTDFLSH    561 - 630
PFGIAVFEDKVFWTDLENEAIFSANRLNGLEISILAENLNNPHDIVIFHELKQPRAPDACELSVQPNGGC    631 - 700
EYLCLPAPQISSHSPKYTCACPDTMWLGPDMKRCYRAPQSTSTTTLASTMTRTVPATTRAPGTTVHRSTY    701 - 770
QNHSTETPSLTAAVPSSVSVPRAPSISPSTLSPATSNHSQHYANEDSKMGSTVTAAVIGIIVPIVVIALL    771 - 840
CMSGYLIWRNWKRKNTKSMNFDNPVYRKTTEEEDEDELHIGRTAQIGHVYPAAISSFDRPLWAEPCLGET    841 - 910
REPEDPAPALKELFVLPGEPRSQLHQLPKNPLSELPVVKSKRVALSLEDDGLP                     911 - 963
//

Text Mined References (81)

PMID Year Title