Property Summary

NCBI Gene PubMed Count 26
Grant Count 4
Funding $132,501
PubMed Score 36.14
PubTator Score 27.22

Knowledge Summary

Patent

No data available

Expression

Gene RIF (11)

PMID Text
26683663 Knockdown of nidogen-2 reduced SOX9 expression, whereas it up-regulated RUNX2 expression
23682613 combined methylation analysis of Twist homolog 1 and nidogen-2 genes may be a simple, noninvasive, sensitive, and specific method for detecting cancer cells in urine.
23681936 The cleavage of nidogen-1 and -2 is partially inhibited in human tumor samples.
21815147 Decreased nidogen-2 expression is associated with hepatocellular carcinoma
21558411 NID2 promoter hypermethylation is associated with oral cavity squamous cell carcinoma.
19883638 Nidogen-2 is a new biomarker for ovarian cancer which correlates closely with CA125.
17328794 CpG islands of both NID1 and NID2 genes are aberrantly methylated in human cancer samples and cancer cell lines.
17008882 nidogen-2 is equivalent to nidogen-1 in skin-organotypic coculture, and both can promote the development of a functional basement membrane zone
12475645 Nidogen-2 compensation hypothesis to explain limited phenotype observed following elimination of nidogen-1 gene.
12005023 found to be ubiquitous component of basement membrane zones underneath developing epithelia of most of the major organ systems; may participate in cell biological functions during human development
More...

AA Sequence

MEGDRVAGRPVLSSLPVLLLLPLLMLRAAALHPDELFPHGESWGDQLLQEGDDESSAVVKLANPLHFYEA      1 - 70
RFSNLYVGTNGIISTQDFPRETQYVDYDFPTDFPAIAPFLADIDTSHGRGRVLYREDTSPAVLGLAARYV     71 - 140
RAGFPRSARFTPTHAFLATWEQVGAYEEVKRGALPSGELNTFQAVLASDGSDSYALFLYPANGLQFLGTR    141 - 210
PKESYNVQLQLPARVGFCRGEADDLKSEGPYFSLTSTEQSVKNLYQLSNLGIPGVWAFHIGSTSPLDNVR    211 - 280
PAAVGDLSAAHSSVPLGRSFSHATALESDYNEDNLDYYDVNEEEAEYLPGEPEEALNGHSSIDVSFQSKV    281 - 350
DTKPLEESSTLDPHTKEGTSLGEVGGPDLKGQVEPWDERETRSPAPPEVDRDSLAPSWETPPPYPENGSI    351 - 420
QPYPDGGPVPSEMDVPPAHPEEEIVLRSYPASGHTTPLSRGTYEVGLEDNIGSNTEVFTYNAANKETCEH    421 - 490
NHRQCSRHAFCTDYATGFCCHCQSKFYGNGKHCLPEGAPHRVNGKVSGHLHVGHTPVHFTDVDLHAYIVG    491 - 560
NDGRAYTAISHIPQPAAQALLPLTPIGGLFGWLFALEKPGSENGFSLAGAAFTHDMEVTFYPGEETVRIT    561 - 630
QTAEGLDPENYLSIKTNIQGQVPYVSANFTAHISPYKELYHYSDSTVTSTSSRDYSLTFGAINQTWSYRI    631 - 700
HQNITYQVCRHAPRHPSFPTTQQLNVDRVFALYNDEERVLRFAVTNQIGPVKEDSDPTPGNPCYDGSHMC    701 - 770
DTTARCHPGTGVDYTCECASGYQGDGRNCVDENECATGFHRCGPNSVCINLPGSYRCECRSGYEFADDRH    771 - 840
TCILITPPANPCEDGSHTCAPAGQARCVHHGGSTFSCACLPGYAGDGHQCTDVDECSENRCHPAATCYNT    841 - 910
PGSFSCRCQPGYYGDGFQCIPDSTSSLTPCEQQQRHAQAQYAYPGARFHIPQCDEQGNFLPLQCHGSTGF    911 - 980
CWCVDPDGHEVPGTQTPPGSTPPHCGPSPEPTQRPPTICERWRENLLEHYGGTPRDDQYVPQCDDLGHFI    981 - 1050
PLQCHGKSDFCWCVDKDGREVQGTRSQPGTTPACIPTVAPPMVRPTPRPDVTPPSVGTFLLYTQGQQIGY   1051 - 1120
LPLNGTRLQKDAAKTLLSLHGSIIVGIDYDCRERMVYWTDVAGRTISRAGLELGAEPETIVNSGLISPEG   1121 - 1190
LAIDHIRRTMYWTDSVLDKIESALLDGSERKVLFYTDLVNPRAIAVDPIRGNLYWTDWNREAPKIETSSL   1191 - 1260
DGENRRILINTDIGLPNGLTFDPFSKLLCWADAGTKKLECTLPDGTGRRVIQNNLKYPFSIVSYADHFYH   1261 - 1330
TDWRRDGVVSVNKHSGQFTDEYLPEQRSHLYGITAVYPYCPTGRK                            1331 - 1375
//

Text Mined References (32)

PMID Year Title
26683663 2016 Laminins and Nidogens in the Pericellular Matrix of Chondrocytes: Their Role in Osteoarthritis and Chondrogenic Differentiation.
25797478 2015 Epithelial basement membrane proteins perlecan and nidogen-2 are up-regulated in stromal cells after epithelial injury in human corneas.
24658283 2014 A genome-wide gene-environment interaction analysis for tobacco smoke and lung cancer susceptibility.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23682613 2013 Hypermethylation of TWIST1 and NID2 in tumor tissues and voided urine in urinary bladder cancer patients.
23681936 2013 Contribution of ADAMTS1 as a tumor suppressor gene in human breast carcinoma. Linking its tumor inhibitory properties to its proteolytic activity on nidogen-1 and nidogen-2.
23658023 2013 Comparative proteomic analysis of supportive and unsupportive extracellular matrix substrates for human embryonic stem cell maintenance.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22952693 2012 Cleavage of nidogen-1 by cathepsin S impairs its binding to basement membrane partners.
More...