Property Summary

NCBI Gene PubMed Count 17
PubMed Score 31.06
PubTator Score 10.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytoma 2.300 0.010
oligodendroglioma 1.100 0.030
osteosarcoma 2.950 0.000
hereditary spastic paraplegia 1.289 0.007
pancreatic ductal adenocarcinoma liver m... 1.654 0.011
psoriasis -1.100 0.000
Alzheimer's disease 1.100 0.022
Pick disease 2.000 0.000
invasive ductal carcinoma -1.300 0.002
ovarian cancer 1.900 0.000
pituitary cancer -2.200 0.000

Synonym

Accession Q14106 Q6FHR7 Q6PIT9 Q9BY97 Q9UBI0
Symbols TOB4
TOBL
APRO5
TROB2

Gene

Gene RIF (6)

PMID Text
25649327 Results show reduced Tob2 expression in primary hepatocellular Carcinoma cells (HCC) and that dysregulation of miR-362 and Tob2 may contribute to HCC malignancy.
22252318 The antiproliferative and the mRNA deadenylation/decay-promoting effects of TOB1 and TOB2 proteins are linked.
21242960 study identifies miR-378-TOB2-cyclin D1 as a functional module to mediate the cross talk between Myc and Ras signaling in cellular transformation
19940862 Haploinsufficiency of the MLL and TOB2 genes in lymphoid malignancy.
19760502 TNFalpha is able to transactivate ErbB-2 and use it as an obligatory downstream signaling molecule in the generation of mitogenic signals.
12135500 Antiproliferative proteins of the BTG/Tob family are degraded by the ubiquitin-proteasome system. the C-terminal regions are necessary and sufficient to control the stabilities of BTG1, BTG2, Tob, and Tob2 proteins.

AA Sequence

MQLEIKVALNFIISYLYNKLPRRRADLFGEELERLLKKKYEGHWYPEKPLKGSGFRCVHIGEMVDPVVEL      1 - 70
AAKRSGLAVEDVRANVPEELSVWIDPFEVSYQIGEKGAVKVLYLDDSEGCGAPELDKEIKSSFNPDAQVF     71 - 140
VPIGSQDSSLSNSPSPSFGQSPSPTFIPRSAQPITFTTASFAATKFGSTKMKKGGGAASGGGVASSGAGG    141 - 210
QQPPQQPRMARSPTNSLLKHKSLSLSMHSLNFITANPAPQSQLSPNAKEFVYNGGGSPSLFFDAADGQGS    211 - 280
GTPGPFGGSGAGTCNSSSFDMAQVFGGGANSLFLEKTPFVEGLSYNLNTMQYPSQQFQPVVLAN          281 - 344
//

Text Mined References (19)

PMID Year Title
25649327 2015 Upregulation of miR-362-3p Modulates Proliferation and Anchorage-Independent Growth by Directly Targeting Tob2 in Hepatocellular Carcinoma.
25416956 2014 A proteome-scale map of the human interactome network.
23340509 2013 Phosphorylation at intrinsically disordered regions of PAM2 motif-containing proteins modulates their interactions with PABPC1 and influences mRNA fate.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22561518 2012 Genome-wide association analyses identify 13 new susceptibility loci for generalized vitiligo.
22252318 2012 Evidence providing new insights into TOB-promoted deadenylation and supporting a link between TOB's deadenylation-enhancing and antiproliferative activities.
21242960 2011 Myc/miR-378/TOB2/cyclin D1 functional module regulates oncogenic transformation.
19940862 2010 Haploinsufficiency of the MLL and TOB2 genes in lymphoid malignancy.
19760502 2010 Transactivation of ErbB-2 induced by tumor necrosis factor alpha promotes NF-kappaB activation and breast cancer cell proliferation.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
More...