Property Summary

NCBI Gene PubMed Count 18
PubMed Score 34.41
PubTator Score 10.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Vitiligo 73 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Primary hypomagnesemia 7 4.481 2.2

Expression

  Differential Expression (11)

Disease log2 FC p
Alzheimer's disease 1.100 2.2e-02
astrocytic glioma 1.300 1.2e-02
hereditary spastic paraplegia 1.289 7.3e-03
invasive ductal carcinoma -1.300 1.9e-03
oligodendroglioma 1.100 3.0e-02
osteosarcoma 2.950 2.9e-06
ovarian cancer 1.900 8.5e-06
pancreatic ductal adenocarcinoma liver m... 1.654 1.1e-02
Pick disease 2.000 2.8e-05
pituitary cancer -2.200 8.0e-05
psoriasis -1.100 1.9e-07

Synonym

Accession Q14106 Q6FHR7 Q6PIT9 Q9BY97 Q9UBI0
Symbols TOB4
TOBL
APRO5
TROB2

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG Inparanoid

Gene RIF (6)

AA Sequence

MQLEIKVALNFIISYLYNKLPRRRADLFGEELERLLKKKYEGHWYPEKPLKGSGFRCVHIGEMVDPVVEL      1 - 70
AAKRSGLAVEDVRANVPEELSVWIDPFEVSYQIGEKGAVKVLYLDDSEGCGAPELDKEIKSSFNPDAQVF     71 - 140
VPIGSQDSSLSNSPSPSFGQSPSPTFIPRSAQPITFTTASFAATKFGSTKMKKGGGAASGGGVASSGAGG    141 - 210
QQPPQQPRMARSPTNSLLKHKSLSLSMHSLNFITANPAPQSQLSPNAKEFVYNGGGSPSLFFDAADGQGS    211 - 280
GTPGPFGGSGAGTCNSSSFDMAQVFGGGANSLFLEKTPFVEGLSYNLNTMQYPSQQFQPVVLAN          281 - 344
//

Text Mined References (20)

PMID Year Title