Property Summary

NCBI Gene PubMed Count 111
PubMed Score 158.63
PubTator Score 139.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung carcinoma 413 1.74409369134808E-18
lung adenocarcinoma 2714 8.48177674399744E-14
Breast cancer 3099 2.13889545443984E-9
ovarian cancer 8492 2.21737373926312E-9
Pick disease 1893 6.33356829963879E-7
malignant mesothelioma 3163 9.32486390728555E-7
osteosarcoma 7933 1.18432115329144E-5
medulloblastoma, large-cell 6234 1.94150976916508E-5
Multiple myeloma 1328 4.90627766136821E-5
tuberculosis and treatment for 6 months 686 3.49927680729276E-4
dermatomyositis 967 5.00416175905759E-4
Waldenstrons macroglobulinemia 765 6.5276812412711E-4
atypical teratoid/rhabdoid tumor 1095 8.08658751947834E-4
lung cancer 4473 0.00258137054672107
subependymal giant cell astrocytoma 2287 0.00445327880442909
progressive supranuclear palsy 674 0.00447549048704219
group 3 medulloblastoma 2254 0.0061896739987229
Subcutaneous panniculitis-like T-cell lymphoma 16 0.0101001420195086
acute myeloid leukemia 785 0.0104516968597091
astrocytic glioma 2241 0.0113807098173959
glioblastoma 5572 0.0126667402037091
oligodendroglioma 2849 0.0127786689394387
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0172527654573207
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0236433188041395
ependymoma 2514 0.0259560531042762
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0312211075608581
active Crohn's disease 918 0.0345688058621768

Expression

Synonym

Accession Q14103 A8K9J2 P07029 Q01858 Q14100 Q14101 Q14102 Q4W5A1 Q9UCE8 Q9UCE9 hnRNP D0
Symbols P37
AUF1
AUF1A
HNRPD
hnRNPD0

Gene

PDB

2Z5N   1HD0   1HD1   1IQT   1WTB   1X0F   5IM0  

  Ortholog (13)

Gene RIF (74)

PMID Text
26805816 hnRNPA2B1, hnRNPD, hnRNPL , and YBX1 might play important roles in gastric cancer tumorigenesis.
26728997 Findings indicate that hnRNP D and arginine methylation play important roles in the regulation of Flt-1 mRNA alternative polyadenylation.
26648300 Down-regulation of hnRNPD inhibits the proliferation of esophageal squamous cell carcinoma cells by promoting cell apoptosis.
26318153 hnRNPD has roles in cellular proliferation and survival, besides RNA splicing and stability in oral cancer
26253535 a novel mechanism by which AUF1 binding and transfer of microRNA let-7 to AGO2 facilitates let-7-elicited gene silencing.
25910425 Functional analysis of selected regulated proteins revealed that knockdown of HNRPD, PHB2 and UB2V2 can increase HCMV replication, while knockdown of A4 and KSRP resulted in decreased HCMV replication.
25908445 in human ovarian, esophageal, and pancreatic cancer tissues, the expression of SOD1 was significantly correlated with that of AUF-1, further supporting the importance of AUF-1 in regulating SOD1 gene expression
25787750 Taken together, these findings proved the inhibitory effect of TP-1 on the growth and metastasis of SMMC-7721 cells, and TP-1 might be offered for future application as a powerful chemopreventive agent against hepatocellular carcinoma (HCC) metastasis.
25720531 These data specify a post-transcriptional mechanism through which AUF1 and YB1 contribute to the normal development of erythropoietic cells, and to non-hematopoietic tissues in which AUF1- and YB1-based regulatory mRNPs assemble on heterologous mRNAs
25486179 Auf1 may play a role in the elimination of oxidized RNA, which is required for the maintenance of proper gene expression under conditions of oxidative stress
More...

AA Sequence

MSEEQFGGDGAAAAATAAVGGSAGEQEGAMVAATQGAAAAAGSGAGTGGGTASGGTEGGSAESEGAKIDA      1 - 70
SKNEEDEGHSNSSPRHSEAATAQREEWKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGF     71 - 140
GFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGGFGEVES    141 - 210
IELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSRGGFAGRAR    211 - 280
GRGGGPSQNWNQGYSNYWNQGYGNYGYNSQGYGGYGGYDYTGYNNYYGYGDYSNQQSGYGKVSRRGGHQN    281 - 350
SYKPY                                                                     351 - 355
//

Text Mined References (129)

PMID Year Title
26805816 2016 Unraveling Molecular Differences of Gastric Cancer by Label-Free Quantitative Proteomics Analysis.
26728997 2016 Regulation of soluble Flt-1 (VEGFR-1) production by hnRNP D and protein arginine methylation.
26648300 2015 [The expression and significance of hnRNPD in esophageal squamous cell carcinoma cells].
26318153 2015 Nuclear heterogeneous nuclear ribonucleoprotein D is associated with poor prognosis and interactome analysis reveals its novel binding partners in oral cancer.
26253535 2015 AUF1 promotes let-7b loading on Argonaute 2.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25910425 2015 Subcellular quantitative proteomic analysis reveals host proteins involved in human cytomegalovirus infection.
25908445 2015 The superoxide dismutase 1 3'UTR maintains high expression of the SOD1 gene in cancer cells: The involvement of the RNA-binding protein AUF-1.
25787750 2015 A Huaier polysaccharide reduced metastasis of human hepatocellular carcinoma SMMC-7721 cells via modulating AUF-1 signaling pathway.
25720531 2015 AUF-1 and YB-1 independently regulate ?-globin mRNA in developing erythroid cells through interactions with poly(A)-binding protein.
More...