Property Summary

NCBI Gene PubMed Count 8
PubMed Score 31.29
PubTator Score 14.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 3.06099649340821E-6
lung cancer 4473 3.36757188849024E-5
Multiple myeloma 1328 9.62113965824621E-5
Waldenstrons macroglobulinemia 765 0.00348475997505094
subependymal giant cell astrocytoma 2287 0.0307913841914664

Expression

  Differential Expression (5)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.443 0.003
Multiple myeloma 2.050 0.000
lung cancer -1.900 0.000
subependymal giant cell astrocytoma -1.916 0.031
ovarian cancer -2.100 0.000

Synonym

Accession Q14094 B2R6M0 B7Z6X4
Symbols CYI
CYC1
CCNI1

Gene

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG

Gene RIF (3)

PMID Text
26698249 A cyclin I-Cdk5 complex forms a critical antiapoptotic factor in the process of generating cisplatin resistance in cervical cancer.
23907122 Knockdown of Cyclin I induced cell cycle arrest at S/G2/M phases.
17507299 The increased levels of cyclin I and GDI2 found to be associated with pancreatic carcinoma were further confirmed by Western blot analyses in an independent series of serum samples and/or pancreatic juice samples

AA Sequence

MKFPGPLENQRLSFLLEKAITREAQMWKVNVRKMPSNQNVSPSQRDEVIQWLAKLKYQFNLYPETFALAS      1 - 70
SLLDRFLATVKAHPKYLSCIAISCFFLAAKTVEEDERIPVLKVLARDSFCGCSSSEILRMERIILDKLNW     71 - 140
DLHTATPLDFLHIFHAIAVSTRPQLLFSLPKLSPSQHLAVLTKQLLHCMACNQLLQFRGSMLALAMVSLE    141 - 210
MEKLIPDWLSLTIELLQKAQMDSSQLIHCRELVAHHLSTLQSSLPLNSVYVYRPLKHTLVTCDKGVFRLH    211 - 280
PSSVPGPDFSKDNSKPEVPVRGTAAFYHHLPAASGCKQTSTKRKVEEMEVDDFYDGIKRLYNEDNVSENV    281 - 350
GSVCGTDLSRQEGHASPCPPLQPVSVM                                               351 - 377
//

Text Mined References (10)

PMID Year Title
26698249 2015 Cyclin I promotes cisplatin resistance via Cdk5 activation in cervical cancer.
23907122 2013 Cyclin I is involved in the regulation of cell cycle progression.
17507299 2007 Serum proteomic-based analysis of pancreatic carcinoma for the identification of potential cancer biomarkers.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9705831 1998 Expression of a novel isoform of cyclin I in human testis.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7493655 1995 Cyclin I: a new cyclin encoded by a gene isolated from human brain.