Property Summary

NCBI Gene PubMed Count 8
Grant Count 51
R01 Count 18
Funding $8,996,755.72
PubMed Score 31.29
PubTator Score 14.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.443 0.003
Multiple myeloma 2.050 0.000
lung cancer -1.900 0.000
subependymal giant cell astrocytoma -1.916 0.031
ovarian cancer -2.100 0.000

Gene RIF (3)

PMID Text
26698249 A cyclin I-Cdk5 complex forms a critical antiapoptotic factor in the process of generating cisplatin resistance in cervical cancer.
23907122 Knockdown of Cyclin I induced cell cycle arrest at S/G2/M phases.
17507299 The increased levels of cyclin I and GDI2 found to be associated with pancreatic carcinoma were further confirmed by Western blot analyses in an independent series of serum samples and/or pancreatic juice samples

AA Sequence

MKFPGPLENQRLSFLLEKAITREAQMWKVNVRKMPSNQNVSPSQRDEVIQWLAKLKYQFNLYPETFALAS      1 - 70
SLLDRFLATVKAHPKYLSCIAISCFFLAAKTVEEDERIPVLKVLARDSFCGCSSSEILRMERIILDKLNW     71 - 140
DLHTATPLDFLHIFHAIAVSTRPQLLFSLPKLSPSQHLAVLTKQLLHCMACNQLLQFRGSMLALAMVSLE    141 - 210
MEKLIPDWLSLTIELLQKAQMDSSQLIHCRELVAHHLSTLQSSLPLNSVYVYRPLKHTLVTCDKGVFRLH    211 - 280
PSSVPGPDFSKDNSKPEVPVRGTAAFYHHLPAASGCKQTSTKRKVEEMEVDDFYDGIKRLYNEDNVSENV    281 - 350
GSVCGTDLSRQEGHASPCPPLQPVSVM                                               351 - 377
//

Text Mined References (10)

PMID Year Title
26698249 2015 Cyclin I promotes cisplatin resistance via Cdk5 activation in cervical cancer.
23907122 2013 Cyclin I is involved in the regulation of cell cycle progression.
17507299 2007 Serum proteomic-based analysis of pancreatic carcinoma for the identification of potential cancer biomarkers.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9705831 1998 Expression of a novel isoform of cyclin I in human testis.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7493655 1995 Cyclin I: a new cyclin encoded by a gene isolated from human brain.