Property Summary

NCBI Gene PubMed Count 10
PubMed Score 10.87
PubTator Score 3.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.5
Melanoma 711 0.0 0.6
Skin cancer 469 0.0 0.5
Disease Target Count Z-score Confidence
Lymphoid leukemia 160 0.0 1.8
Disease Target Count Z-score Confidence
Weill-Marchesani syndrome 14 3.98 2.0

Gene RIF (2)

AA Sequence

MSLPRFQRVNFGPYDNYIPVSELSKKSWNQQHFALLFPKPQRPGTKRRSKPSQIRDNTVSIIDEEQLRGD      1 - 70
RRQPLWMYRSLMRISERPSVYLAARRQPLKPTRTVEVDSKAAEIGKKGEDKTTQKDTTDSESELKQGKKD     71 - 140
SKKGKDIEKGKEEKLDAKKDSKKGKKDAEKGKDSATESEDEKGGAKKDNKKDKKDSNKGKDSATESEGEK    141 - 210
GGTEKDSKKGKKDSKKGKDSAIELQAVKADEKKDEDGKKDANKGDESKDAKKDAKEIKKGKKDKKKPSST    211 - 280
DSDSKDDVKKESKKDATKDAKKVAKKDTEKESADSKKDAKKNAKKDAKKDAKKNAKKDEKKDAKKKGK      281 - 348
//

Text Mined References (11)

PMID Year Title